Home | Community | Message Board
You are not signed in.
Sign In New Account
Forum Index Search Posts Trusted Vendors Highlights Galleries FAQ User List Chat Store Random Growery

Magic-Mushrooms-Shop.com
This site includes paid links. Please support our sponsors.

Community > The Pub
Threaded Mode Threaded  Previous topic Previous  View all topics Index  Next topic Next 

Welcome to the Shroomery Message Board! You are experiencing a small sample of what the site has to offer. Please login or register to post messages and view our exclusive members-only content. You'll gain access to additional forums, file attachments, board customizations, encrypted private messages, and much more!

Shop: Original Sensible Seeds Feminized Cannabis Seeds   Myyco.com Golden Teacher Liquid Culture For Sale

Jump to first unread post Pages: | 1 | 2 | 3 | 4 |  [ show all ]
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: RiverDweller1]
    #24059625 -

Trump probably think Depp is an amateur spender.


--------------------

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: RiverDweller1]
    #24059631 -

RiverDweller1 said:
that's the great thing about earning your own money.  You can do what you want with it and everyone else can straight fuck off.

Oh how we love to hate and make a spectacle of those who have things we desire but can't achieve ourselves!


Relax, lady. I'm a fan of the dude for fuck's sake. It's the pub. It's a place to bullshit about bullshit.

Beautiful pics, by the way.


--------------------
:niffla:

ACADEMY AWARD WINNING ACTOR
WG32 KILLED HOFFA
PROFESSIONAL BALL BUFFERER
WORST NEIGHBORHOOD YARD OF 2026 WINNER
OTD’S FORMER PRODIGAL SON
TODAY IS BEER DAY

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: Nifflerz] * 1
    #24059638 -

:seriousbusiness:


--------------------

Diminish the sub-principle and leave its toxic trace..
Once and for all!

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: Nifflerz]
    #24059658 -

Niffla said:
RiverDweller1 said:
that's the great thing about earning your own money.  You can do what you want with it and everyone else can straight fuck off.

Oh how we love to hate and make a spectacle of those who have things we desire but can't achieve ourselves!


Relax, lady. I'm a fan of the dude for fuck's sake. It's the pub. It's a place to bullshit about bullshit.

Beautiful pics, by the way.


I'm so relaxed right now!  :smile: Thanks for the pic compliment too.

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: RiverDweller1] * 1
    #24059674 -

RiverDweller1 said:
that's the great thing about earning your own money.  You can do what you want with it and everyone else can straight fuck off.

Oh how we love to hate and make a spectacle of those who have things we desire but can't achieve ourselves!


A rich person living outside their means is no different than someone with little money. Money isn't just money. Money is life, kinda like that movie In Time. Your assessment sucks and wreaks of projected butthurt.

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: SyzygisticSoul]
    #24059677 -

SyzygisticSoul said:
Looks like it's time to make another Pirates of the carribean movie


The first 2 were good, the rest suck.

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: larry.fisherman]
    #24059693 -

XLCaps said:
RiverDweller1 said:
that's the great thing about earning your own money.  You can do what you want with it and everyone else can straight fuck off.

Oh how we love to hate and make a spectacle of those who have things we desire but can't achieve ourselves!


A rich person living outside their means is no different than someone with little money. Money isn't just money. Money is life, kinda like that movie In Time. Your assessment sucks and wreaks of projected butthurt.


I'm not butthurt about anything.  What you earn (or don't earn) is your own personal business.

I heard about an hour's worth of commentary on this topic on the radio yesterday.  Those were butthurt people. Most of them were saying that he should be spending that money on "the poor".  Most were coloring him unfavorably as a human based on his spending of money that was HIS They are what prompted my comment on this thread. 

If anyone wants to draw lines to things I don't believe or feel, they are welcome to.  It makes me laugh so that's something of value.

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: RiverDweller1]
    #24059722 -

It's not his own personal business. Lack of privacy comes with that great achievement we apparently have no talent to possess. That is what he wanted. He's probably even making money off the publicity. Hell for all you know that could have been his idea.

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: larry.fisherman]
    #24059736 -

The money you earn and what you do with it is your OWN PERSONAL BUSINESS.  That statement says nothing about expectations of privacy or secrecy.  #allyourlinesarescribbles

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: RiverDweller1] * 2
    #24059748 -

Nope.

Hey tell me, those couple people that possess the majority of the world's money and are essentially feeding in to global poverty, should their expenditure be totally their business? #wealthcapsandsmartassfaggyhashtags

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: larry.fisherman]
    #24059757 -

You could start a thread about that and see, I suppose.  Although, by now it should be rather obvious to you that I don't support telling people what to do with their money.

#stayontopicyouweirdoconclusiondrawinglefty

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: RiverDweller1] * 2
    #24059763 -

It's called a conversation. Sorry you're above that. I'll remember that next time you whine about something irrelevant.

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: larry.fisherman]
    #24059812 -

Why do these dudes never get prenups?  It's fucking statistically shown that these chicks only get up with them to pump out two kids and then divorse them within 10 years.  How can they not know what chicks do?

Also, Nightmare on Elm St.2 was terrible and it's only redeeming value is the dance scene in the bedroom.  Fact.


--------------------

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: Amanita86]
    #24059823 -

Nignored

FACT

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: Amanita86] * 1
    #24059863 -

Nightmare on Elm Street 2 was one of the gayest horror movies ever! LOL!

http://decider.com/2015/11/01/nightmare-on-elm-street-gay/

There’s a different premise to this film. Freddy Krueger is back, of course, but rather than murdering his victims in their sleep, he taunts the unsuspecting Jesse Walsh, whose family has moved into that spooky house on Elm Street. It’s through Jesse’s body that Freddy continues his murderous rampage, manipulating him into carrying out his evil deeds. It did not receive nearly as much praise as the original film, but the film is still infamous for one particular reason: it’s gay as hell.

But then here’s the most outrageous — and hilarious — sequence, which takes place after Jesse wakes up from a nightmare and inexplicably wanders into a leather bar. Who does he run into? His sadistic gym teacher, naturally.



Totally normal. Totally heterosexual. Just two men being real masculine together in a completely non-sexual way. And then he brings Jesse back to the gym, late at night, to run laps and shower, which is in no way similar to a single gay porn film I’ve ever seen. Well, it is, until Coach is tied up by a mysterious force and then whipped with towels while Jesse watches. (Also, huh?!)


Jesse runs from his girlfriend and his hesitation toward having sex with her, and where does he end up? In the bedroom of his best friend, Ron, to whom Jesse screams, “Something is trying to get inside my body!” Ron naturally replies, “Yeah, and she’s female and she’s waiting for you in the cabana and you want to sleep with me.” (Of course he does, Ron!) And while Jesse’s struggle with his sexuality is certainly the subtext of the film, there’s also the text of the film, which is weapons-grade gay.

Take, for example, the fun little dance / sunglass modeling Jesse does when he’s cleaning his room:



The crazy thing is that this happened at all, but apparently what seems pretty blatant now was conveniently over the heads of those who worked on the film. In Never Sleep Again: The Elm Street Legacy, a three-hour documentary about the Nightmare on Elm Street franchise, screenwriter David Chaskin pretty much admitted that it wasn’t all naiveté — the homosexual subtext was intended. And actor Mark Patton, who starred as Jesse (and who later publicly came out as gay), also confessed that he pretty much figured out what was going on. The director, however, had his head in the clouds the whole damn time. (Who knows if the prop department was in on it. How else do you explain a game on Jesse’s closet called Probe?)


--------------------

Edited by tyrannicalrex (02/02/17 12:42 PM)

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: psi]
    #24059889 -

psi said:
Yeah he's got some decent range. A lot of very well-paid Hollywood "actors" pretty much act the same role in everything they're in. For example Keanu Reeves. In the Bill and Ted movies, Speed, Johnny Mnemonic, The Matrix and every other fucking thing he's in, he is essentially playing exactly the same "dumb guy" character in different costumes and settings.


I see no parallels between Bill and Ted and The Martix. Way different characters....

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: larry.fisherman] * 1
    #24059894 -

Johnny Depp is just another dickhole Hollywood liberal. Over paid, over rated, pretentious spoiled cheese dick

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: 1234go]
    #24059907 -

1234go said:
SARAtonin said:
The woman beater deserves no sympathy.


::notyou:


So you think it's ok for him to hit women because he's famous?
Or.......?


--------------------
Maiden, Mother, and Crone.

You are Me and I am You.

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: SARAtonin] * 2
    #24059923 -

There's no reason to think he did and everything coming forward is suggesting he never did. At least as far as I've seen.

Extras: Filter Print Post Top
Re: Johnny Depp's alleged spending habits rival that of a small country [Re: larry.fisherman]
    #24059987 -

XLCaps said:
Nignored

FACT


I ignored you first fool!:crankey:  You need to learn some facts..


--------------------

Extras: Filter Print Post Top
Jump to top Pages: | 1 | 2 | 3 | 4 |  [ show all ]

Shop: Original Sensible Seeds Feminized Cannabis Seeds   Myyco.com Golden Teacher Liquid Culture For Sale

Community > The Pub
Threaded Mode Threaded  Previous topic Previous  View all topics Index  Next topic Next 

Similar ThreadsPosterViewsRepliesLast post
* Johnny Depp
( 1 2 all )		 drSE 2,341 30 07/22/07 03:34 PM
by drSE
* Johnny Depp funds Hunter S. Thompson's Funeral
( 1 2 all )		 OneMoreRobot3021 2,587 20 05/27/05 09:04 PM
by Noetical
* Depp Arranges Shooting of Thompson's Ashes RandalFlagg 741 3 05/27/05 11:48 AM
by afoaf
* R.I.P. Johnny Ramone silversoul7 690 3 09/17/04 03:44 PM
by Phishgrrl
* How much do you spend on entertainment utilities? schmutzen 2,000 19 08/19/07 12:09 PM
by tiny_rabid_birds
* Bad habits
( 1 2 3 all )		 CaRnAgECaNdYS 3,346 40 02/27/05 11:17 PM
by Dark_Star
* Little Johnny Joke HagbardCeline 635 2 11/21/03 03:28 PM
by Anonymous
* I think my roomate has a coke habit... FunkyLoFi 2,938 14 07/17/06 04:47 PM
by Schwip

Extra information
You cannot start new topics / You cannot reply to topics
HTML is disabled / BBCode is enabled
Moderator: Entire Staff
1,806 topic views. 4 members, 86 guests and 119 web crawlers are browsing this forum.
[ Show Images Only | Sort by Score | Print Topic ]
Search this thread:

Copyright 1997-2026 Mind Media. Some rights reserved.

Generated in 0.038 seconds spending 0.005 seconds on 18 queries.