Home | Community | Message Board

Sporeworks
This site includes paid links. Please support our sponsors.


Welcome to the Shroomery Message Board! You are experiencing a small sample of what the site has to offer. Please login or register to post messages and view our exclusive members-only content. You'll gain access to additional forums, file attachments, board customizations, encrypted private messages, and much more!

Shop: Mushroom-Hut Liquid Cultures   Left Coast Kratom Buy Kratom Capsules   PhytoExtractum Buy Bali Kratom Powder   Original Sensible Seeds Bulk Cannabis Seeds   North Spore Bulk Substrate   Bridgetown Botanicals Bridgetown Botanicals   Kraken Kratom Kratom Capsules for Sale   Unfolding Nature Unfolding Nature: Being in the Implicate Order

Jump to first unread post Pages: 1 | 2 | 3  [ show all ]
Offlinenickchinn
Stranger

Registered: 05/15/21
Posts: 21
Last seen: 7 hours, 59 minutes
Anyone use UV-C for sterilization?
    #28615994 - 01/10/24 05:47 AM (17 days, 21 hours ago)

Probably posted before, looked around. I found a UV-C light on major online retailer (A-Z). Aparently these C wave black lights will kill fungal spores, viruses, bacteria. It interrupts DNA. As a HVAC tech. We sometimes install these lights in large units at hospitals in the air supply, but I ways thought it was a placebo to upcharge contractors. Since it’s $17 with a 4.7⭐️ at 1160 reviews, I feel like it worth turning on and leaving for 10 minutes in my work area. Some guy in the reviews said he tested it on his N95 masks and it works.

Anyone try this, or have honest feedback?


Extras: Filter Print Post Top
OfflineSilentraindrops
mushlove student
I'm a teapot
Registered: 12/23/23
Posts: 222
Loc: pnw
Last seen: 3 hours, 19 minutes
Re: Anyone use UV-C for sterilization? [Re: nickchinn]
    #28615996 - 01/10/24 05:53 AM (17 days, 21 hours ago)

You are asking a question about uv light , that you basically answered lol .

UV exposer can do damage do not work under it.

Cleaning you area isn't going to stop the bacteria in the air when you move....

LOTS of people us uv to sterilize but you can do that with many other methods too... I've used uv to sterilize other things but not my SaB , it's not really a "sterile" air box and keeping it that way would be meh.
It depends on what area/ what you are doing ?


--------------------


Edited by Silentraindrops (01/10/24 06:01 AM)


Extras: Filter Print Post Top
Offlinenickchinn
Stranger

Registered: 05/15/21
Posts: 21
Last seen: 7 hours, 59 minutes
Re: Anyone use UV-C for sterilization? [Re: nickchinn]
    #28616004 - 01/10/24 06:17 AM (17 days, 21 hours ago)

I wouldn’t work under it. Like it claims, interrupts dna. My work area and grow area are in my walk in closet. I thought about mounting it to wall above my SAB. Turning on and walking away for 10 minutes. Then spraying down myself with alcohol like usual and turning off before I go in. At least killing a significant amount of spores prior to me walking in. I know it works. What I’m asking is: are home UV-C tube lights powerful enough to do this? $17? Before I stumbled on this I assumed a UV light powerful enough to sterilize an area is something you’d have to buy commercially. Just wondering if others have had success with this


Extras: Filter Print Post Top
OfflinePscientist
KushKaptain
Male


Folding@home Statistics
Registered: 11/13/09
Posts: 2,679
Loc: Sirius X1
Last seen: 6 hours, 34 minutes
Re: Anyone use UV-C for sterilization? [Re: nickchinn]
    #28616009 - 01/10/24 06:26 AM (17 days, 20 hours ago)

Some modern lab equipment will come with these installed to sanitize the work surface. The usage protocol is to turn the light on for 15 minutes before and after work but not to work with it on. UV light can be damaging to your eyes as well as your DNA.



--------------------
Any information posted on this website from this account is hypothetical and only to be used for legal purposes. :super:


Edited by Pscientist (01/10/24 02:14 PM)


Extras: Filter Print Post Top
OfflineRoscoeReturnsS
Crotchety chode man
Male


Registered: 02/12/18
Posts: 1,738
Loc: State of Confusion
Last seen: 6 hours, 55 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist] * 3
    #28616224 - 01/10/24 10:35 AM (17 days, 16 hours ago)

No no no, please no. Stop with the UV lights. Everything that needs to be sterile goes through the PC. UV light damages skin, retinas, almost all plastic and rubber. In addition, it will not work anywhere there is a shadow, so any stuff in your closet or dirt or really anything that will block the light renders this whole thing useless. You are drastically raising your risk level for absolutely no benefit.

Also stop dousing yourself with iso. Not necessary.

Lab equipment companies still sell UV in their hoods as a way to make money. Most labs I worked in stopped using UV years ago because of the dangers of UV coupled with the ineffectiveness in actual use conditions.


Extras: Filter Print Post Top
InvisibleWay
The


Registered: 01/14/23
Posts: 4,336
Loc: A long way away
Re: Anyone use UV-C for sterilization? [Re: RoscoeReturns]
    #28616304 - 01/10/24 11:49 AM (17 days, 15 hours ago)



--------------------

That's the way she goes, boys. Sometimes she goes, sometimes she doesn't, cause that's the fuckin way she goes.


Extras: Filter Print Post Top
Invisiblestarvinghooker
Voyager
 User Gallery


Registered: 04/16/23
Posts: 533
Re: Anyone use UV-C for sterilization? [Re: nickchinn]
    #28616338 - 01/10/24 12:22 PM (17 days, 14 hours ago)

Whether of not you are able to sterilize 100% of everything inside an SAB would make no difference.  Eventually, you're going go be introducing contams on whatever you place in the box (your hands, tools, etc.) Abd the moment you take everything out of your box it's as if the light was never there.  It's complete and totally unnecessary overkill.


--------------------
Grab life by the balls and yank on 'em til everything you want comes gushing out in thick, creamy ribbons

Noob like me? Start here!
Hitchhiker's Guide to the Shroomery



Extras: Filter Print Post Top
Invisiblestubb
Dahg Rastubfari
 User Gallery

Registered: 03/23/19
Posts: 1,310
Loc: Memory Flag
Re: Anyone use UV-C for sterilization? [Re: nickchinn] * 1
    #28616341 - 01/10/24 12:23 PM (17 days, 14 hours ago)

Quote:

nickchinn said:
Some guy in the reviews said he tested it on his N95 masks and it works.





Quote:

I buy this light to sterilize my n95 masks. It is very important that this light do sterilize. If my mask is not properly clean and I believe it is clean,then I will end up cross contamination. I test it by putting a thin polyester smelly sock inside a small box to sterilize for 5 minutes. The sock came out smelly. So I want to return it. But after fellow amazon customers reply to my concerns, I decide to keep it. Seller also sees my questions and provides documents to proof that this is a real uvc light and at the same time to solve my questions on why my smelly sock comes out smelly after sterilization. After answering all the questions seller asks, seller tells me to use it for 15 minutes and the smelly sock came out clean. Proof provides by the seller is not as persuasive as my own test which gives me a peace of mind.

I sterilize my n95 mask, car keys, letters, shoes, jackets and backpacks. In the past, I have to leave everything I used outside in my garage, read my letters in my garage, spray my car keys with alcohol, air out my n95 mask for ten days in order to reuse. Putting on a jacket that might be contaminated is really scary too. Oh. I just hate all these worries.

Now, after testing out myself that this light do sterilize. I sterilize everything I use from the outside. Thousands thanks to my fellow amazon customers who help me out and to the seller who has a lot of patience for answering all the questions. Having a light that really do the job is very important. Thanks to everyone

I put the light on the carton box to sterilize my masks but I don’t want my jacket to explose to uv because too much uv will lighten the fabric. I separated the jacket and the masks by using the carton.




:wowjustwow:


--------------------
:mushroomgrow:
🆃🄴🅰🄼  🅲🄻🅸🄽🅶🅆🆁🄰🅿

You wake up. The room is spinning very gently round your head. Or at least it would be if you could see it which you can't.
It is pitch black.

> TURN ON LIGHT


Extras: Filter Print Post Top
OfflinePscientist
KushKaptain
Male


Folding@home Statistics
Registered: 11/13/09
Posts: 2,679
Loc: Sirius X1
Last seen: 6 hours, 34 minutes
Re: Anyone use UV-C for sterilization? [Re: RoscoeReturns]
    #28616368 - 01/10/24 12:43 PM (17 days, 14 hours ago)

Quote:

RoscoeReturns said:
No no no, please no. Stop with the UV lights. Everything that needs to be sterile goes through the PC. UV light damages skin, retinas, almost all plastic and rubber. In addition, it will not work anywhere there is a shadow, so any stuff in your closet or dirt or really anything that will block the light renders this whole thing useless. You are drastically raising your risk level for absolutely no benefit.

Also stop dousing yourself with iso. Not necessary.

Lab equipment companies still sell UV in their hoods as a way to make money. Most labs I worked in stopped using UV years ago because of the dangers of UV coupled with the ineffectiveness in actual use conditions.





There is a difference between sterilization and disinfection of a surface! They are not interchangeable.

Sterilization of equipment (where appropriate and possible) is good, sterilization in combination with a disinfected/decontmainated surface is better.

I never claimed UV can replace sterilization, but it helps create a cleaner work environment.


--------------------
Any information posted on this website from this account is hypothetical and only to be used for legal purposes. :super:


Edited by Pscientist (01/10/24 01:09 PM)


Extras: Filter Print Post Top
OfflineRoscoeReturnsS
Crotchety chode man
Male


Registered: 02/12/18
Posts: 1,738
Loc: State of Confusion
Last seen: 6 hours, 55 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist] * 1
    #28616729 - 01/10/24 06:33 PM (17 days, 8 hours ago)

Quote:

Pscientist said:

There is a difference between sterilization and disinfection of a surface! They are not interchangeable.

Sterilization of equipment (where appropriate and possible) is good, sterilization in combination with a disinfected/decontmainated surface is better.

I never claimed UV can replace sterilization, but it helps create a cleaner work environment.




Yes you are correct. Sterilization and disinfection are different. They are not interchangeable. My response was not directed at your comment except for the last regarding UV in hoods.

UV does not work for our purposes and poses a very real risk that many discount. Just because it looks cool in a lab catalog does not mean we should be putting these things in our closet.


Extras: Filter Print Post Top
Offlinenickchinn
Stranger

Registered: 05/15/21
Posts: 21
Last seen: 7 hours, 59 minutes
Re: Anyone use UV-C for sterilization? [Re: nickchinn]
    #28619998 - 01/13/24 04:41 PM (14 days, 10 hours ago)

What I have researched, and I may be totally wrong, is a two step process.

step 1: UV-C light that produces O3 (OZONE) in the area on for 15-30 minutes [turning on outside of area to prevent exposure] killing and sanitizing everything in direct light as well as the OZONE killing everything in the shadows and underneath tables etc that can be "wafted up" or "stirred up" in the air just from movements.

step 2: UV-C light OZONE free that destroys OZONE [turning on for 30 minutes after step 1 light is turned off]. This returns the air to normal conditions so the individual can work without respiratory irritation.

This is simply a $17 addition to my new grow area. My previous work area was where ever I had space; computer desk, bathroom, kitchen island, etc. As an on and off grower since 2010, I've had many frustrating contams that just ruined everything.

Now that I've moved and have a walk in closet with my own personal space for my extracurricular activity, I want it to be clean, easy, and effective.

But most importantly "mad scientist" like fun, this is a hobby! :smile: so go big!

My Room plan:

Two single pole/single throw toggle switches (or simply home depot normal light switches) wired to the two UV-C lamps on ceiling and installed light switch height outside the closet next to door. One for each light. Red LEDs installed above each switch indicating which light is currently on. both switches will be additionally wired to a "Soviet Era" warning lamp likened to something in Chernobyl and a warning sign on door .

As an HVAC Installation, Service and Repair Technician, I have the skill and materials I need to wire this awesome "mad scientist lab", save the warning sign and lamp.

I also have installed these UV-C lights inside major air handling units in hospitals, military barracks, hotels, office buildings. Just about anywhere there are multiple rooms that share centralized air and the potential for stagnant humidity and moisture. The return portion of HVAC recycles the air through filters (the ones at walmart you always forget to replace every three months and I have to explain the importance of them) and in many cases, we have installed tubular UV-C lights after the filters to kill *ahem* MOLD SPORES small enough to pass through dust filters, before sending the climatized air back through the building. I wanted to empathize that I am not ignorant to this, I have not used this type of disinfectant procedure on a small level for personal use. $17 and an extra 45 minutes wait before walking into work area to me sounds worth it. I was just curious if anyone has had good results using this.


Extras: Filter Print Post Top
OfflineHappinessStan
Fungivore
Male User Gallery


Registered: 10/10/12
Posts: 1,612
Loc: Worcester, UK
Last seen: 11 hours, 56 minutes
Re: Anyone use UV-C for sterilization? [Re: Silentraindrops]
    #28620010 - 01/13/24 05:10 PM (14 days, 10 hours ago)

Quote:

Silentraindrops said:
You are asking a question about uv light , that you basically answered lol .

UV exposer can do damage do not work under it.

Cleaning you area isn't going to stop the bacteria in the air when you move....

LOTS of people us uv to sterilize but you can do that with many other methods too... I've used uv to sterilize other things but not my SaB , it's not really a "sterile" air box and keeping it that way would be meh.
It depends on what area/ what you are doing ?



I used to work in aquatics, some dude came in and asked for a uvc light for his aquarium, my boss assumed he meant a uvc light for his uv steriliser (a contained water filter that kills pathogens and parasites with uvc light). Turned out he meant a uv light for his saltwater tank.
Plugged it in, worked fine, so he started working on cleaning out his tank. Ended up with 3rd degree burns all over his face and arms after less than an hour.
Luckily, he realised it was his fault for not specifying which bulb he needed. That could've ended in a very heavy lawsuit.
Tldr; don't fuck about with uvc.


--------------------



Extras: Filter Print Post Top
InvisibleNillion
Nobody

Registered: 04/14/22
Posts: 1,000
Loc: Terra Firma
Re: Anyone use UV-C for sterilization? [Re: nickchinn]
    #28620015 - 01/13/24 05:14 PM (14 days, 10 hours ago)

Effect of ultraviolet C irradiation on growth and antibacterial activity of Fomitopsis betulina

Exposure of Trichoderma isolates to different doses of UV radiation for development of mutants and their stability in subsequent generations

Edible and medicinal fungi breeding techniques, a review: Current status and future prospects

SANITATION OF MUSHROOM (AGARICUS BISPORUS) WITH UV-C LIGHT

Effect of light on quality of preharvest and postharvest edible mushrooms and its action mechanism: A review

_____________

These are all titles of articles that may interest people in relation to this topic.

UV-C light is a mutagenic agent in many fungi, it has more promise in relation to breeding than it does in terms of sterilization. That's an advanced topic though and there really isn't much call for its use in the growing of sacred fungi. For those using it as a mutagenic agent a simple handheld wand is effective, but it's tricky to use. I won't share the basic methods but they can be found by searching online. It also has some uses when it comes to plants. I use it on cactus seedlings, for example. I also wear glasses that block UV light and avoid exposing my skin to the light when working with it.


Extras: Filter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: nickchinn]
    #28620049 - 01/13/24 05:48 PM (14 days, 9 hours ago)

So why not install a couple lights in your HVAC system on the other side of your filter so you lights don't get dirty? To remain on at all times and purify the air as is passes by the lights just be sure to shield your filter from light so it doesn't get destroyed

I think I'm running a couple 24w uvc in the HVAC

Uvc can make silicone crumble after less than a year as well, makeshift fishtank parasite killer/oxengenator. Be careful dangerous in lots of ways not just eye damage, lung damage ect

It creates ozone and hits pollen spores ECT with so much energy it knocks DNA out of place and replaces it with different molecules or whatever

O3 ozone is very unstable so as long as it gets tumbled around in the air for awhile it becomes 02 and isn't in high concentrations it isn't dangerous but it can be very very bad if used incorrectly

It can smell like chlorine and burn your lungs after it's been turned off it can destroy plastic in minutes, leave it black at the very least

They aren't going to fix your problems or maybe help much for mushrooms but they can keep the over all air cleaner

It can only clean a surface and destroy that surface if it's not resistant to it so it's almost useless for mushrooms, that's what alcohol or a flame or PC is for on most things

In a SAB if the light isn't blocked will turn your tub black

If you don't know what your doing and you just install for a company without knowledge of uvc please stay away from it before you do unrepairable damage to yourself

It's more useful in things like a fish tank with clear water where you can't use chemicals or heat to kill parasites or to oxidize ammonia

Just using the basic mycology tools will lead to way more success than trying to use something you don't fully understand

Please please stay away from it if you have to ask about it instead of understanding how it works and the dangers associated with it

They have lots of space in a store a few low power light bulbs isn't going to be dangerous like it could be at home


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Filter Print Post Top
Offlinenickchinn
Stranger

Registered: 05/15/21
Posts: 21
Last seen: 7 hours, 59 minutes
Re: Anyone use UV-C for sterilization? [Re: nickchinn] * 1
    #28620832 - 01/14/24 11:03 AM (13 days, 16 hours ago)

I install it where the blueprints tell me. I’m not an architectural engineer by no means. I appreciate the attack on my trade as well. That is why I am here asking the question. I have installed it based on plans that have been approved by the government and hospital boards. To kill mold spores that pass through filters, and thought it would be a beneficial idea to my home setup. A simple yes it works or I haven’t seen any results would have been fine HelloImBob. “Please please stay away from it if you have to ask about it instead of understanding how it works and the dangers associated with it” if that is your philosophy on life, then maybe you shouldn’t go to advanced or auto zone and ask for help with replacing spark plugs. If you don’t understand it, just shut up and do what you know? How about you don’t discourage expansion of knowledge and learning new things. I’ll take your advice and next time I have to go to a house with a owner that has your type of attitude, I’ll say, “I can’t do it, I don’t understand and shouldn’t ask questions!” Literally, telling me to not educate myself and ask questions was pretty shitty.


Extras: Filter Print Post Top
InvisibleNillion
Nobody

Registered: 04/14/22
Posts: 1,000
Loc: Terra Firma
Re: Anyone use UV-C for sterilization? [Re: nickchinn]
    #28620845 - 01/14/24 11:09 AM (13 days, 16 hours ago)

It works and most UV-C lights don't create enough ozone to be a big problem. Hospitals use the lights and there doesn't seem to be ozone related health issues associated with working in a hospital.

In fact, when someone is harmed from ozone poisoning they go to a hospital for treatment where UV-C units are common and they recover just fine.

It's also useful for niche applications as a mutagenic agent as mentioned.

It may not offer distinct advantages for cultivators who already have excellent technique or a laminar flow hood.


Extras: Filter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: nickchinn]
    #28620932 - 01/14/24 12:08 PM (13 days, 15 hours ago)

Quote:

nickchinn said:
I install it where the blueprints tell me. I’m not an architectural engineer by no means. I appreciate the attack on my trade as well. That is why I am here asking the question. I have installed it based on plans that have been approved by the government and hospital boards. To kill mold spores that pass through filters, and thought it would be a beneficial idea to my home setup. A simple yes it works or I haven’t seen any results would have been fine HelloImBob. “Please please stay away from it if you have to ask about it instead of understanding how it works and the dangers associated with it” if that is your philosophy on life, then maybe you shouldn’t go to advanced or auto zone and ask for help with replacing spark plugs. If you don’t understand it, just shut up and do what you know? How about you don’t discourage expansion of knowledge and learning new things. I’ll take your advice and next time I have to go to a house with a owner that has your type of attitude, I’ll say, “I can’t do it, I don’t understand and shouldn’t ask questions!” Literally, telling me to not educate myself and ask questions was pretty shitty.




Lol wow I'm sorry I didn't realize I was talking to a little girl on her period who obviously doesn't understand what I'm saying

You sound like one of those kids who has never been told no and just starts throwing a fit instead of asking for better understanding

Some things aren't meant to be toys

Some things do not belong in this hobby except for very special cases if that

I'm all about creative solutions and learning or I wouldn't have bothered replying. I could have just laughed to myself and said some kid is gonna play around with uv-c hahaha

I have another idea let's all replace our lightbulbs with tanning bulbs

Uv-c is amazing but it's mainly for special purposes, outside of those purposes it can be very dangerous to somebody who doesn't know what they are doing with it yet

Is it as dangerous as a kid finding a loaded gun? Probably not but do you get the idea?

All I'm saying is look elsewhere for solutions until you understand it better at the very least

If you don't take the initiative to learn the basics about something complex don't expect somebody to waste their time trying to explain it to you

Sure I could have spent a little more time making sure I wrote more organized or easier to understand but I don't think it would have mattered anyways

Shit grow up a bit I was only trying to warn you it can be dangerous, you went from asking for help to throwing a fit it makes you look really dumb regardless if you are or not

I'm sorry everybody I'm not usually so rude

P.s.
Waytowriteanentiremessagewithoutevenusingaparagraphitmakesitwayeasiertoread


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Filter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Nillion]
    #28620955 - 01/14/24 12:29 PM (13 days, 14 hours ago)

Quote:

Nillion said:
It works and most UV-C lights don't create enough ozone to be a big problem. Hospitals use the lights and there doesn't seem to be ozone related health issues associated with working in a hospital.

In fact, when someone is harmed from ozone poisoning they go to a hospital for treatment where UV-C units are common and they recover just fine.

It's also useful for niche applications as a mutagenic agent as mentioned.

It may not offer distinct advantages for cultivators who already have excellent technique or a laminar flow hood.




If you didn't read my post about how o3 breaks down into o2 after being tumbled in the air for awhile being used in HVAC and how stores are large buildings just like hospitals are large

The ozone is supposed to break down or at least get diluted enough before reaching people

A uvc light is an ozone generator in small amounts but it doesn't take much to burn your lungs over time like breathing chlorine if it's used incorrectly and even smells like chlorine if allowed to collect in an area without air movement

Are most people going to run 200+watts of uv-c and create enough ozone to maybe do lung damage? No

But direct exposure to the bulb can cause DNA damage and possibly instant eye damage, I personally don't want to try it to see for sure

I bet you could use a custom blu ray laser pointer to heat your needle red hot instead of a lighter or alcohol lamp

I mean we could all come up with obscure ways to do things instead of the tried and true methods people write teks about for no reason

I'm sorry if I'm being rude but I don't fully understand uvc

maybe because I know enough for what I use it for like fish tanks or HVAC but I've seen it turn silicone to crumbs in less than a year maybe 6 months and do things that make the worst sun burn you have ever seen look like nothing

It scares me

People should be afraid of it if they knew what it could do

The risk to reward ratio on that one is just not worth it


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Filter Print Post Top
InvisibleStipe-n CapMDiscord
Male User Gallery

Registered: 08/04/12
Posts: 7,623
Loc: Canada
Trusted Cultivator
Re: Anyone use UV-C for sterilization? [Re: HelloImBob] * 1
    #28624550 - 01/17/24 12:35 PM (10 days, 14 hours ago)

These have become my new most hated threads :lol:

Quote:

Stipe-n Cap said:
UV-C lamps are not permitted on cabinets at the NIH because the risk outweighs the benefit, If it's not good enough for them, it's not good enough for you.

UV-C provides a false sense of security, much like using antibacterial agar but without gruesome DNA mutations. UV-C has very few, if any uses for home cultivation purposes, unless you're attempting some advanced mutagenesis type shenanigans.

UV-C absolutely does not outperform isopropyl for sanitizing your work surfaces, ISO conveniently comes with zero risk. You cannot sanitize the atmosphere, so stop trying.

UV-C is subject to the inverse-square law,  cannot penetrate glass, plastic, or liquids which makes UV quite pointless for mush cult. Even if UV-C were 100% effective, the moment the light is switched off in a normal open air environment, any benefit gained on the swings is lost on the roundabouts.


Quote:


Ultraviolet radiation is a form of non-ionizing radiation, and biological effects from it vary with wavelength, photon energy, and duration of exposure. The 100-280 nm wavelength band is designated as UV-C, which is used for germicidal purposes.

The sterilization/decontamination activity of UV lights is limited by a number of factors, including:

Penetration – In the dynamic air streams of BSCs, microorganisms beneath dust particles, plastics, and work surfaces are not affected by the UV light because it cannot penetrate particles so far from the UV source.

Relative humidity – The germicidal effects of UV light drop off precipitously when relative humidity is above 70%.

Temperature and air movement – The optimum temperature for the UV lamp to be effective is 77-80 degrees F. Temperatures below this range result in reduced efficacy, and air movement can exacerbate this.

Cleanliness – Dust and dirt block the germicidal effectiveness of the UV lamp, so weekly cleanings are necessary.

Age – Check UV lamps every six months to assure proper function, as the amount of germicidal wavelength emitted decreases with bulb age and hours of use.

Overuse – UV lights are routinely left on overnight or longer in an effort to decontaminate workspaces, but this practice can result in the germicidal wavelength no longer being produced by the bulb.

For these reasons and other concerns, the National Sanitation Foundation (NSF) does not recommend the use of UV lights




https://www.ehs.washington.edu/about/latest-news/trouble-uv-light-your-biosafety-cabinet


The National Sanitation Foundation  discourages the use of UV-C. UV-C has no place in your home cult lab. UV-C is absolutely 100% pointless and represents an unnecessary health risk. Straight up noobs arguing in favor of x technique or technology without the appropriate foundational knowledge/wisdom appears to be becoming the hallmark of psychoactive fungi cultivation.

Take pride in your work, do the appropriate research, and listen to those here who have been around for a while; You might be surprised to discover that they actually know a thing or two.

If you have questions regarding equipment function and efficacy, read this:

https://www.shroomery.org/forums/showflat.php/Number/27615199





:howyoudoing:




Extras: Filter Print Post Top
OfflinePscientist
KushKaptain
Male


Folding@home Statistics
Registered: 11/13/09
Posts: 2,679
Loc: Sirius X1
Last seen: 6 hours, 34 minutes
Re: Anyone use UV-C for sterilization? [Re: Stipe-n Cap]
    #28624766 - 01/17/24 04:01 PM (10 days, 11 hours ago)

Quote:

Stipe-n Cap said:
UV-C lamps are not permitted on cabinets at the NIH because the risk outweighs the benefit, If it's not good enough for them, it's not good enough for you.





In your claim you mention the risks of UV but then go on to say.


Quote:

Stipe-n Cap said:
UV-C is subject to the inverse-square law,  cannot penetrate glass, plastic, or liquids which makes UV quite pointless for mush cult.





When used properly UV light really isn't that unsafe, with an emphasis on properly. Does UV work to help sanitize a surface? Yes. Is it necessary for the work people do on this website? No. Are shoes necessary to walk outside? No.


Quote:

Stipe-n Cap said:
Even if UV-C were 100% effective, the moment the light is switched off in a normal open air environment, any benefit gained on the swings is lost on the roundabouts.





I agree with parts of this statement, but when you shut the light off the entire surface doesn't immediately become as contaminated as when you started (necessarily). Contaminants will fall randomly onto the surface over time. So the benefit is not all lost immediately, it is lost gradually over time (with regards to the surface sanitization). The light doesn't have to be used in an open air environment as you described though.



Quote:

Stipe-n Cap said:
UV-C provides a false sense of security, much like using antibacterial agar but without gruesome DNA mutations.





This is an unrelated point, but are you claiming antibacterial agar doesn't impede the growth of bacterial species that are sensitive to the antibiotic being used? I have to disagree with that.

Quote:

Stipe-n Cap said:
UV-C has very few, if any uses for home cultivation purposes, unless you're attempting some advanced mutagenesis type shenanigans.





This is probably true for the most part, but the OP was asking about the use of UV for sanitization purposes.


Quote:

Stipe-n Cap said:
UV-C absolutely does not outperform isopropyl for sanitizing your work surfaces, ISO conveniently comes with zero risk. You cannot sanitize the atmosphere, so stop trying.





Iso is flammable and must be purchased regularly, so there are risks and greater requirements for resupply. In an ideal world you should use both for maximum sanitization.

Also just to be a further contrarian, you can technically sanitize and even sterilize the atmosphere in small spaces like labs, this is how labs are decontaminated in cases of serious biological release. It can be done with formaldehyde gas, but before you even say it, of course it has no place in this line of work.


I agree with everything below.
Quote:


Ultraviolet radiation is a form of non-ionizing radiation, and biological effects from it vary with wavelength, photon energy, and duration of exposure. The 100-280 nm wavelength band is designated as UV-C, which is used for germicidal purposes.

The sterilization/decontamination activity of UV lights is limited by a number of factors, including:

Penetration – In the dynamic air streams of BSCs, microorganisms beneath dust particles, plastics, and work surfaces are not affected by the UV light because it cannot penetrate particles so far from the UV source.

Relative humidity – The germicidal effects of UV light drop off precipitously when relative humidity is above 70%.

Temperature and air movement – The optimum temperature for the UV lamp to be effective is 77-80 degrees F. Temperatures below this range result in reduced efficacy, and air movement can exacerbate this.

Cleanliness – Dust and dirt block the germicidal effectiveness of the UV lamp, so weekly cleanings are necessary.

Age – Check UV lamps every six months to assure proper function, as the amount of germicidal wavelength emitted decreases with bulb age and hours of use.

Overuse – UV lights are routinely left on overnight or longer in an effort to decontaminate workspaces, but this practice can result in the germicidal wavelength no longer being produced by the bulb.

For these reasons and other concerns, the National Sanitation Foundation (NSF) does not recommend the use of UV lights





:sun:


--------------------
Any information posted on this website from this account is hypothetical and only to be used for legal purposes. :super:


Extras: Filter Print Post Top
InvisibleStipe-n CapMDiscord
Male User Gallery

Registered: 08/04/12
Posts: 7,623
Loc: Canada
Trusted Cultivator
Re: Anyone use UV-C for sterilization? [Re: Pscientist] * 1
    #28624773 - 01/17/24 04:05 PM (10 days, 11 hours ago)

K


Extras: Filter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist]
    #28624791 - 01/17/24 04:19 PM (10 days, 11 hours ago)

And how many people here are going to use it properly compared to not?

It's like playing with fire, there is a higher chance something bad is going to happen than it being helpful.

Plus what is properly in this hobby?

It has it's uses but it's better for fish tanks and post filter HVAC.

It scares me to think somebody who doesn't know what they are doing tries using it only to ruin their eyesight or something.

When something is contaminated get rid of it or do agar transfers or whatever.


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Filter Print Post Top
OfflinePscientist
KushKaptain
Male


Folding@home Statistics
Registered: 11/13/09
Posts: 2,679
Loc: Sirius X1
Last seen: 6 hours, 34 minutes
Re: Anyone use UV-C for sterilization? [Re: HelloImBob]
    #28624798 - 01/17/24 04:24 PM (10 days, 10 hours ago)

Quote:

HelloImBob said:
It's like playing with fire, there is a higher chance something bad is going to happen than it being helpful.






Some may say that about a lot of things in this hobby, it all depends on perspective. It doesn't change facts.


--------------------
Any information posted on this website from this account is hypothetical and only to be used for legal purposes. :super:


Extras: Filter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist]
    #28624809 - 01/17/24 04:32 PM (10 days, 10 hours ago)

Quote:

Pscientist said:
Quote:

HelloImBob said:
It's like playing with fire, there is a higher chance something bad is going to happen than it being helpful.






Some may say that about a lot of things in this hobby, it all depends on perspective. It doesn't change facts.




Change what facts that it's simpler to grow mushrooms without using uv-c?

That it's more useful in HVAC or a fish tank?


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Filter Print Post Top
InvisibleStipe-n CapMDiscord
Male User Gallery

Registered: 08/04/12
Posts: 7,623
Loc: Canada
Trusted Cultivator
Re: Anyone use UV-C for sterilization? [Re: HelloImBob] * 1
    #28624815 - 01/17/24 04:35 PM (10 days, 10 hours ago)

Sanitizing with soap, iso, or some other agent, is far more efficient/practical than UV. Noobs are constantly trying to reinvent the wheel by complicating things.

Still air? Too simple, what about a shmuvbox 🤔

Sanitation? Why use boring old sanitizing agents when we can harness the power of the electromagnetic spectrum🤔

Monotub? You mean automated air exchangers  controlled by PID, hygrometer, and co2 sensors🤔

But, what if I used all of these 🤔 I bet I'm the first to consider the massive implications for exponential gainz.



Or perhaps My fingers just have frostbite from hanging out too long at the summet of mount stupid.



Extras: Filter Print Post Top
OfflinePscientist
KushKaptain
Male


Folding@home Statistics
Registered: 11/13/09
Posts: 2,679
Loc: Sirius X1
Last seen: 6 hours, 34 minutes
Re: Anyone use UV-C for sterilization? [Re: HelloImBob]
    #28624822 - 01/17/24 04:37 PM (10 days, 10 hours ago)

I don't think the OP was asking for the simplest way to grow mushrooms, I recall something about the uses of UV for sanitization.


--------------------
Any information posted on this website from this account is hypothetical and only to be used for legal purposes. :super:


Extras: Filter Print Post Top
OfflinePscientist
KushKaptain
Male


Folding@home Statistics
Registered: 11/13/09
Posts: 2,679
Loc: Sirius X1
Last seen: 6 hours, 34 minutes
Re: Anyone use UV-C for sterilization? [Re: Stipe-n Cap]
    #28624832 - 01/17/24 04:42 PM (10 days, 10 hours ago)

Quote:

Stipe-n Cap said:
Sanitizing with soap, iso, or some other agent, is far more efficient/practical than UV. Noobs are constantly trying to reinvent the wheel by complicating things.

Still air? Too simple, what about a shmuvbox 🤔

Sanitation? Why use boring old sanitizing agents when we can harness the power of the electromagnetic spectrum🤔

Monotub? You mean automated air exchangers  controlled by PID, hygrometer, and co2 sensors🤔

But, what if I used all of these 🤔 I bet I'm the first to consider the massive implications for exponential gainz.



Or perhaps My fingers just have frostbite from hanging out too long at the summet of mount stupid.







Who hurt you?


--------------------
Any information posted on this website from this account is hypothetical and only to be used for legal purposes. :super:


Extras: Filter Print Post Top
InvisibleStipe-n CapMDiscord
Male User Gallery

Registered: 08/04/12
Posts: 7,623
Loc: Canada
Trusted Cultivator
Re: Anyone use UV-C for sterilization? [Re: Pscientist] * 1
    #28624834 - 01/17/24 04:42 PM (10 days, 10 hours ago)

The answer:

Don't use UV in place of sanitizing agents like 70% isopropyl.

Quote:

For these reasons and other concerns, the National Sanitation Foundation (NSF) does not recommend the use of UV lights in BSCs.




The National Sanitation Foundation doesn't even recommend it, so just don't. Check out what boring old soap can do:



Isopropyl is widely used, the fumes are irrelevant, but do whatever you guy's want, I'm not even your real dad anyways.

Quote:

Pscientist said:
Who hurt you?




I have PNSD (post noob stress disorder) from engaging in so many asinine conversations over the years.



Extras: Filter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist]
    #28624880 - 01/17/24 05:03 PM (10 days, 10 hours ago)

It's useless unless you have a special quartz glass, useless if it's not transparent, useless useless useless for 99% of the people that's might attempt to use it and just end up hurting themselves in the process

Sure there might be some use for it but should people that don't know any better play around with something that has a way higher chance of being dangerous than it does useful?

If you cared about your fellow man you wouldn't defend a topic that could so easily cause them harm without them knowing any better.

They can be dangerous and there is no point to them in this hobby unless your smart enough to figure out that reason on your own.

I'm all ears if you come up with a tek on how to use it correctly

It's not like we're trying to keep a secret hidden from everybody.


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Filter Print Post Top
InvisibleStipe-n CapMDiscord
Male User Gallery

Registered: 08/04/12
Posts: 7,623
Loc: Canada
Trusted Cultivator
Re: Anyone use UV-C for sterilization? [Re: HelloImBob] * 1
    #28624946 - 01/17/24 05:25 PM (10 days, 9 hours ago)

UV is essentially a Noob Goldberg machine, like all of the other over-nooblicated contraptions listed above. Does UV sanitize shit? Let me answer with a question: Do humidifiers add humidity to monotubs?

Sure, breh. Do whatever makes Y'all happy. I only post to add balance to otherwise ridiculous threads overrun by the unjustifiably overconfident, you know, for posterity and the folks who've figured out the search function.

Am I salty, yes, but what's life without a healthy pinch of salt? Anywho, did you know that labs running UV used to report folks with sick tans? true story. Worse case scenario you'll end up looking like a bronze myco-stud.


Extras: Filter Print Post Top
Invisiblestubb
Dahg Rastubfari
 User Gallery

Registered: 03/23/19
Posts: 1,310
Loc: Memory Flag
Re: Anyone use UV-C for sterilization? [Re: nickchinn]
    #28625572 - 01/18/24 06:48 AM (9 days, 20 hours ago)

Quote:

Pscientist said:
Quote:

Stipe-n Cap said:
UV-C lamps are not permitted on cabinets at the NIH because the risk outweighs the benefit, If it's not good enough for them, it's not good enough for you.





In your claim you mention the risks of UV but then go on to say.


Quote:

Stipe-n Cap said:
UV-C is subject to the inverse-square law,  cannot penetrate glass, plastic, or liquids which makes UV quite pointless for mush cult.





When used properly UV light really isn't that unsafe, with an emphasis on properly. Does UV work to help sanitize a surface? Yes. Is it necessary for the work people do on this website? No. Are shoes necessary to walk outside? No.


Quote:

Stipe-n Cap said:
Even if UV-C were 100% effective, the moment the light is switched off in a normal open air environment, any benefit gained on the swings is lost on the roundabouts.





I agree with parts of this statement, but when you shut the light off the entire surface doesn't immediately become as contaminated as when you started (necessarily). Contaminants will fall randomly onto the surface over time. So the benefit is not all lost immediately, it is lost gradually over time (with regards to the surface sanitization). The light doesn't have to be used in an open air environment as you described though.



Quote:

Stipe-n Cap said:
UV-C provides a false sense of security, much like using antibacterial agar but without gruesome DNA mutations.





This is an unrelated point, but are you claiming antibacterial agar doesn't impede the growth of bacterial species that are sensitive to the antibiotic being used? I have to disagree with that.

Quote:

Stipe-n Cap said:
UV-C has very few, if any uses for home cultivation purposes, unless you're attempting some advanced mutagenesis type shenanigans.





This is probably true for the most part, but the OP was asking about the use of UV for sanitization purposes.


Quote:

Stipe-n Cap said:
UV-C absolutely does not outperform isopropyl for sanitizing your work surfaces, ISO conveniently comes with zero risk. You cannot sanitize the atmosphere, so stop trying.





Iso is flammable and must be purchased regularly, so there are risks and greater requirements for resupply. In an ideal world you should use both for maximum sanitization.

Also just to be a further contrarian, you can technically sanitize and even sterilize the atmosphere in small spaces like labs, this is how labs are decontaminated in cases of serious biological release. It can be done with formaldehyde gas, but before you even say it, of course it has no place in this line of work.


I agree with everything below.
Quote:


Ultraviolet radiation is a form of non-ionizing radiation, and biological effects from it vary with wavelength, photon energy, and duration of exposure. The 100-280 nm wavelength band is designated as UV-C, which is used for germicidal purposes.

The sterilization/decontamination activity of UV lights is limited by a number of factors, including:

Penetration – In the dynamic air streams of BSCs, microorganisms beneath dust particles, plastics, and work surfaces are not affected by the UV light because it cannot penetrate particles so far from the UV source.

Relative humidity – The germicidal effects of UV light drop off precipitously when relative humidity is above 70%.

Temperature and air movement – The optimum temperature for the UV lamp to be effective is 77-80 degrees F. Temperatures below this range result in reduced efficacy, and air movement can exacerbate this.

Cleanliness – Dust and dirt block the germicidal effectiveness of the UV lamp, so weekly cleanings are necessary.

Age – Check UV lamps every six months to assure proper function, as the amount of germicidal wavelength emitted decreases with bulb age and hours of use.

Overuse – UV lights are routinely left on overnight or longer in an effort to decontaminate workspaces, but this practice can result in the germicidal wavelength no longer being produced by the bulb.

For these reasons and other concerns, the National Sanitation Foundation (NSF) does not recommend the use of UV lights





:sun:




:shoedick:
Is this an endorsement? What's supposed to be the takeaway from all that?

OP asked:
Quote:

nickchinn said:
Anyone try this, or have honest feedback?



Have you? Do you?


--------------------
:mushroomgrow:
🆃🄴🅰🄼  🅲🄻🅸🄽🅶🅆🆁🄰🅿

You wake up. The room is spinning very gently round your head. Or at least it would be if you could see it which you can't.
It is pitch black.

> TURN ON LIGHT


Extras: Filter Print Post Top
OfflineMwj12977
OLD DAD
 User Gallery

Registered: 12/12/23
Posts: 72
Last seen: 15 hours, 12 minutes
Re: Anyone use UV-C for sterilization? [Re: stubb]
    #28625622 - 01/18/24 07:52 AM (9 days, 19 hours ago)

If these bulbs create ozone then why is everyone so worried about our ozone layer? Can’t we just make a bunch of giant ozone producing light bulbs to repair it? Just kidding! 😂


Extras: Filter Print Post Top
Invisiblestubb
Dahg Rastubfari
 User Gallery

Registered: 03/23/19
Posts: 1,310
Loc: Memory Flag
Re: Anyone use UV-C for sterilization? [Re: Mwj12977] * 1
    #28625712 - 01/18/24 09:34 AM (9 days, 17 hours ago)

You jest, but things like that were considered. O3's heavier than O2 tho, the ozone layer is suspended betwixt the upward convection of the troposphere and the downward weight of the stratosphere. No good way to generate or to transport generated ozone up there, more practical to find alternatives to ozone depleting substances.


--------------------
:mushroomgrow:
🆃🄴🅰🄼  🅲🄻🅸🄽🅶🅆🆁🄰🅿

You wake up. The room is spinning very gently round your head. Or at least it would be if you could see it which you can't.
It is pitch black.

> TURN ON LIGHT


Extras: Filter Print Post Top
OfflinePscientist
KushKaptain
Male


Folding@home Statistics
Registered: 11/13/09
Posts: 2,679
Loc: Sirius X1
Last seen: 6 hours, 34 minutes
Re: Anyone use UV-C for sterilization? [Re: stubb]
    #28625831 - 01/18/24 11:40 AM (9 days, 15 hours ago)

Quote:

stubb said:
Quote:

Pscientist said:
Quote:

Stipe-n Cap said:
UV-C lamps are not permitted on cabinets at the NIH because the risk outweighs the benefit, If it's not good enough for them, it's not good enough for you.





In your claim you mention the risks of UV but then go on to say.


Quote:

Stipe-n Cap said:
UV-C is subject to the inverse-square law,  cannot penetrate glass, plastic, or liquids which makes UV quite pointless for mush cult.





When used properly UV light really isn't that unsafe, with an emphasis on properly. Does UV work to help sanitize a surface? Yes. Is it necessary for the work people do on this website? No. Are shoes necessary to walk outside? No.


Quote:

Stipe-n Cap said:
Even if UV-C were 100% effective, the moment the light is switched off in a normal open air environment, any benefit gained on the swings is lost on the roundabouts.





I agree with parts of this statement, but when you shut the light off the entire surface doesn't immediately become as contaminated as when you started (necessarily). Contaminants will fall randomly onto the surface over time. So the benefit is not all lost immediately, it is lost gradually over time (with regards to the surface sanitization). The light doesn't have to be used in an open air environment as you described though.



Quote:

Stipe-n Cap said:
UV-C provides a false sense of security, much like using antibacterial agar but without gruesome DNA mutations.





This is an unrelated point, but are you claiming antibacterial agar doesn't impede the growth of bacterial species that are sensitive to the antibiotic being used? I have to disagree with that.

Quote:

Stipe-n Cap said:
UV-C has very few, if any uses for home cultivation purposes, unless you're attempting some advanced mutagenesis type shenanigans.





This is probably true for the most part, but the OP was asking about the use of UV for sanitization purposes.


Quote:

Stipe-n Cap said:
UV-C absolutely does not outperform isopropyl for sanitizing your work surfaces, ISO conveniently comes with zero risk. You cannot sanitize the atmosphere, so stop trying.





Iso is flammable and must be purchased regularly, so there are risks and greater requirements for resupply. In an ideal world you should use both for maximum sanitization.

Also just to be a further contrarian, you can technically sanitize and even sterilize the atmosphere in small spaces like labs, this is how labs are decontaminated in cases of serious biological release. It can be done with formaldehyde gas, but before you even say it, of course it has no place in this line of work.


I agree with everything below.
Quote:


Ultraviolet radiation is a form of non-ionizing radiation, and biological effects from it vary with wavelength, photon energy, and duration of exposure. The 100-280 nm wavelength band is designated as UV-C, which is used for germicidal purposes.

The sterilization/decontamination activity of UV lights is limited by a number of factors, including:

Penetration – In the dynamic air streams of BSCs, microorganisms beneath dust particles, plastics, and work surfaces are not affected by the UV light because it cannot penetrate particles so far from the UV source.

Relative humidity – The germicidal effects of UV light drop off precipitously when relative humidity is above 70%.

Temperature and air movement – The optimum temperature for the UV lamp to be effective is 77-80 degrees F. Temperatures below this range result in reduced efficacy, and air movement can exacerbate this.

Cleanliness – Dust and dirt block the germicidal effectiveness of the UV lamp, so weekly cleanings are necessary.

Age – Check UV lamps every six months to assure proper function, as the amount of germicidal wavelength emitted decreases with bulb age and hours of use.

Overuse – UV lights are routinely left on overnight or longer in an effort to decontaminate workspaces, but this practice can result in the germicidal wavelength no longer being produced by the bulb.

For these reasons and other concerns, the National Sanitation Foundation (NSF) does not recommend the use of UV lights





:sun:




:shoedick:
Is this an endorsement? What's supposed to be the takeaway from all that?







Yes, it is. Glad you were able to decipher that :cookiemonster:.

UV + iso > iso alone (for sanitizing a surface).


--------------------
Any information posted on this website from this account is hypothetical and only to be used for legal purposes. :super:


Extras: Filter Print Post Top
Invisiblestubb
Dahg Rastubfari
 User Gallery

Registered: 03/23/19
Posts: 1,310
Loc: Memory Flag
Re: Anyone use UV-C for sterilization? [Re: Pscientist]
    #28625895 - 01/18/24 12:53 PM (9 days, 14 hours ago)

Right on. I've only used UV-C tubes for EPROMs. Definitely underestimated it, burned myself pretty good first time I erased a bunch.
How do you employ your UV-C tube for cult work?


--------------------
:mushroomgrow:
🆃🄴🅰🄼  🅲🄻🅸🄽🅶🅆🆁🄰🅿

You wake up. The room is spinning very gently round your head. Or at least it would be if you could see it which you can't.
It is pitch black.

> TURN ON LIGHT


Extras: Filter Print Post Top
Offlinenormalperson
Stranger
 User Gallery

Registered: 10/31/19
Posts: 728
Last seen: 22 hours, 41 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist] * 1
    #28625947 - 01/18/24 01:53 PM (9 days, 13 hours ago)

I think that it would be best that a person practice their sterile technique instead of relying on either chemicals or uv lights to produce clean work. this shit ain't rocket science.


Extras: Filter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: normalperson]
    #28626108 - 01/18/24 04:13 PM (9 days, 11 hours ago)

I will be so glad when this thread stops being bumped.


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Filter Print Post Top
OfflinePscientist
KushKaptain
Male


Folding@home Statistics
Registered: 11/13/09
Posts: 2,679
Loc: Sirius X1
Last seen: 6 hours, 34 minutes
Re: Anyone use UV-C for sterilization? [Re: HelloImBob]
    #28626119 - 01/18/24 04:18 PM (9 days, 11 hours ago)

It seems a few here are suggesting we shouldn't discuss something because it could be dangerous when not used in a safe and informed way?

That's a very enlightened perspective. I wonder if that concept has ever failed culturally in the past? :mushroom2:


--------------------
Any information posted on this website from this account is hypothetical and only to be used for legal purposes. :super:


Extras: Filter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist]
    #28626244 - 01/18/24 05:31 PM (9 days, 9 hours ago)

You sound brilliant.

When you figure out a way to use it, let us know.

Until then I'll only use it for HVAC and fish tanks, EEPROMS ect.

How are you going to sterilize something that grows beneath the surface?

Use agar for cleaning up a culture.

People here waste time and energy trying to do things that will fail instead of doing them the ways that work and have been described in full detail with pictures.

It doesn't get much easier than starting clean grain spawn over and over until you run out of room instead of trying to fix a problem that isn't broken.

Throw out your contams and start over unless your trying to save a rare ass clone or something and in which case you probably aren't in this situation.


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Filter Print Post Top
OfflinePscientist
KushKaptain
Male


Folding@home Statistics
Registered: 11/13/09
Posts: 2,679
Loc: Sirius X1
Last seen: 6 hours, 34 minutes
Re: Anyone use UV-C for sterilization? [Re: HelloImBob]
    #28626282 - 01/18/24 05:55 PM (9 days, 9 hours ago)

There are many possible solutions.

You could purchase a grow tent (6 ft x 4 ft 6ft) for your work and place the uv lamp above your work surface (small desk in tent). You can iso the surface before, shut the tent and turn on the light with the tent closed for 10 minutes and then shut the light off (all from the outside of the tent using the UV lamp cable).

Then go in and iso the surface again if you want (or don't I don't care what anyone does here).

Or you could mount one in a SAB (with an external power cable), UV doesn't really pass through plastic as some naysayers have already pointed out.

Instead of being sure something can't work people should open their minds a bit and think of ways it could.

I want to be clear, I think most of the work people do here can be done in open air, but if we are talking optimal setups there is no need to be close-minded.


--------------------
Any information posted on this website from this account is hypothetical and only to be used for legal purposes. :super:


Edited by Pscientist (01/18/24 05:56 PM)


Extras: Filter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist]
    #28626297 - 01/18/24 06:05 PM (9 days, 9 hours ago)

Lol close minded have you ever used one?

They destroy plastic and tent materials they destroy everything but glass and even oxidize metals horribly except maybe stainless steel.

I have used them in the past and they scare me with how destructive they can be. Silicone is meant to last 50 years in the sun outside. Didn't last 6 months in a gallon jar sealing some uv-c lights around the lid for a fish tank parasite killer.

Do you have any experience with them?

I do

They destroy everything and are dangerous.

I'm smart enough to know that I'm not smart enough to use uv-c for mushrooms if there is a use at all.

Wtf happened to common sense?


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Filter Print Post Top
OfflinePscientist
KushKaptain
Male


Folding@home Statistics
Registered: 11/13/09
Posts: 2,679
Loc: Sirius X1
Last seen: 6 hours, 34 minutes
Re: Anyone use UV-C for sterilization? [Re: HelloImBob]
    #28626303 - 01/18/24 06:10 PM (9 days, 9 hours ago)

Quote:

HelloImBob said:
Lol close minded have you ever used one?

They destroy plastic and tent materials they destroy everything but glass and even oxidize metals horribly except maybe stainless steel.

I have used them in the past and they scare me with how destructive they can be. Silicone is meant to last 50 years in the sun outside. Didn't last 6 months in a gallon jar sealing some uv-c lights around the lid for a fish tank parasite killer.

Do you have any experience with them?

I do

They destroy everything and are dangerous.

I'm smart enough to know that I'm not smart enough to use uv-c for mushrooms if there is a use at all.

Wtf happened to common sense?





Ok Bob, stay scared :bobbyhill:


--------------------
Any information posted on this website from this account is hypothetical and only to be used for legal purposes. :super:


Extras: Filter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist] * 1
    #28626307 - 01/18/24 06:14 PM (9 days, 9 hours ago)

Lol says the blind guy with DNA damage who likes to play with uv-c

Way to dodge the question if you have experience with them.

If you had experience you would know they destroy plastic and just about everything else.


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Filter Print Post Top
OfflinePscientist
KushKaptain
Male


Folding@home Statistics
Registered: 11/13/09
Posts: 2,679
Loc: Sirius X1
Last seen: 6 hours, 34 minutes
Re: Anyone use UV-C for sterilization? [Re: HelloImBob]
    #28626320 - 01/18/24 06:21 PM (9 days, 9 hours ago)

UV does make plastic brittle with prolonged exposure.

If you turned a UV light on in a tent for 10 minutes twice a month it would do very little damage and still last quite a long time.


Keep trying though bob :bobbyhill:


--------------------
Any information posted on this website from this account is hypothetical and only to be used for legal purposes. :super:


Extras: Filter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist]
    #28626346 - 01/18/24 06:35 PM (9 days, 8 hours ago)

Lol you have no clue because you haven't used them before.

Yes I am smart enough to be afraid of some things, just like being afraid of fire to some extent. Even in a nomex fire suit you can still die of heat even if you don't burn up.

Other things like nitroglycerin scare me too, obliviously if you handle it correctly and keep it cold it shouldn't blow up on you.

I'm not invincible if I make a mistake with uv-c I could cause permanent eye damage or DNA damage, lung damage ect...

I use uv-c for other purposes and I make sure to have switches in other rooms or extension cords away from exposure.

It not only makes plastic brittle it turns it black.

Maybe I should make some examples one day with a CCTV camera recording uv-c vs plastic, I just need another DVR first.

You sound really dumb like you like to play with fire.

Fire has it's uses but can get out of hand really easy just like this thread.


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Filter Print Post Top
OfflinePscientist
KushKaptain
Male


Folding@home Statistics
Registered: 11/13/09
Posts: 2,679
Loc: Sirius X1
Last seen: 6 hours, 34 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist]
    #28626356 - 01/18/24 06:40 PM (9 days, 8 hours ago)

Quote:

Pscientist said:
Ok Bob, stay scared :bobbyhill:




--------------------
Any information posted on this website from this account is hypothetical and only to be used for legal purposes. :super:


Extras: Filter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist]
    #28626368 - 01/18/24 06:51 PM (9 days, 8 hours ago)

Lol get some experience playing around with uv-c then come back and talk.

Stupid people act like it's not smart to be afraid of some things then usually end up missing limbs or dead.


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Filter Print Post Top
OfflineOldManRiver
Fisherman at large
Male User Gallery

Registered: 11/12/17
Posts: 416
Loc: Pacific NW USA
Last seen: 3 hours, 7 minutes
Re: Anyone use UV-C for sterilization? [Re: HelloImBob] * 1
    #28626418 - 01/18/24 07:46 PM (9 days, 7 hours ago)

Quote:

HelloImBob said:
Lol you have no clue because you haven't used them before.





I have, Bob.  By overstating your case, you reduce your credibility on your valid points. 

UVC is dangerous. That's the freaking point.  UVC demonstrably kills certain pathogens interesting to us, notably trichoderma spores.  That's also the freaking point.  I can still see, I don't have three eyes, my tubs have not degraded into dust.


Extras: Filter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: OldManRiver]
    #28626432 - 01/18/24 08:02 PM (9 days, 7 hours ago)

Overstating my case? DNA damage is known as what cancer?

Tell me how it's useful below the surface?

It works great in clear water or clean air.

By all means I'm done with this thread. I hope you all play with uv-c I don't give a shit anymore.

This has by far got to be the stupidest thread I've ever wasted my time on.


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Filter Print Post Top
InvisibleLadysKnight
Hello Ladies
 User Gallery

Registered: 10/09/15
Posts: 1,654
Re: Anyone use UV-C for sterilization? [Re: HelloImBob]
    #28626440 - 01/18/24 08:15 PM (9 days, 7 hours ago)



Extras: Filter Print Post Top
OfflinePscientist
KushKaptain
Male


Folding@home Statistics
Registered: 11/13/09
Posts: 2,679
Loc: Sirius X1
Last seen: 6 hours, 34 minutes
Re: Anyone use UV-C for sterilization? [Re: HelloImBob] * 1
    #28626483 - 01/18/24 08:57 PM (9 days, 6 hours ago)

Quote:

HelloImBob said:
Overstating my case? DNA damage is known as what cancer?

Tell me how it's useful below the surface?

It works great in clear water or clean air.

By all means I'm done with this thread. I hope you all play with uv-c I don't give a shit anymore.

This has by far got to be the stupidest thread I've ever wasted my time on.





It's ok to be scared of UV bob, don't use it.

Other adults may choose to learn the dangers of UV and how to use it safely.

It doesn't change your life. At the same time, there is no reason to shoot down the discussion.


:peace:


--------------------
Any information posted on this website from this account is hypothetical and only to be used for legal purposes. :super:


Extras: Filter Print Post Top
InvisibleGoatrider
Rhythm Guitarist
Male


Registered: 04/08/20
Posts: 4,396
Loc: Germany
Re: Anyone use UV-C for sterilization? [Re: HelloImBob] * 1
    #28626682 - 01/19/24 02:22 AM (9 days, 59 minutes ago)

Quote:

HelloImBob said:
Overstating my case? DNA damage is known as what cancer?

Tell me how it's useful below the surface?

It works great in clear water or clean air.

By all means I'm done with this thread. I hope you all play with uv-c I don't give a shit anymore.

This has by far got to be the stupidest thread I've ever wasted my time on.




First of all i wanna say that i´m absolutely with you.

But discussions like that lead into nothingness.
I formerly had to learn it the hard way in a thread,
when a guy (a vendor) advised to add peroxide to their misting bottle regularly.
The rage began, finally our big admin needed to jump in,
and even strengthened this guys back quite a bit.
For a moment i thought about setting up a password
i wouldn´t remember, and better leave this place.

But stories like that will always happen.
It´s human.
I don´t care anymore.

Let´s be proud we´re able to produce great yields
without UV or H2O2, that´s real cultivation.

Folks, just make clean spawn and start work.

Otherwise just do what y`all want,
as said i don´t care,
just wanted to place my statement.

          :cookiemonster:


--------------------


Extras: Filter Print Post Top
Offlinethe man
still masked
Other User Gallery


Registered: 08/12/99
Posts: 6,681
Loc: C A N A D A
Last seen: 2 days, 6 hours
Re: Anyone use UV-C for sterilization? [Re: HappinessStan]
    #28627807 - 01/19/24 09:15 PM (8 days, 6 hours ago)

Quote:

HappinessStan said:

I used to work in aquatics, some dude came in and asked for a uvc light for his aquarium, my boss assumed he meant a uvc light for his uv steriliser (a contained water filter that kills pathogens and parasites with uvc light). Turned out he meant a uv light for his saltwater tank.
Plugged it in, worked fine, so he started working on cleaning out his tank. Ended up with 3rd degree burns all over his face and arms after less than an hour.
Luckily, he realised it was his fault for not specifying which bulb he needed. That could've ended in a very heavy lawsuit.
Tldr; don't fuck about with uvc.





sounds made up... different plugs, sizes etc.  lesson, dont listen to guys who smell like fish....prone to make things up :wink:


Extras: Filter Print Post Top
OfflineOldManRiver
Fisherman at large
Male User Gallery

Registered: 11/12/17
Posts: 416
Loc: Pacific NW USA
Last seen: 3 hours, 7 minutes
Re: Anyone use UV-C for sterilization? [Re: the man] * 1
    #28628896 - 01/20/24 05:15 PM (7 days, 10 hours ago)

Bob, spare us the straw man arguments.  You might inquire as to how people are using the UVC light, before telling us that we're all going to die. 

Nobody is arguing that UVC penetrates and kills stuff below a surface.  Nobody is recommending having them on when you are in the room.  Nobody is recommending leaving them on all the time. 

I use them to knock back trich spores in the air and on surfaces.  I run them in my room for 30 min just before I do bulk spawn operations, in conjunction with other standard sanitization measures. I'll run them after I do a periodic room clean, after vacuuming, as the dust settles in the room.  I turn them on and off from outside the room, behind a closed door. Used this way, there is no risk to the grower.  Whether there is benefit is up for discussion, but it's straightforward to use them safely.  They are proven to kill mold spores and bacteria on surfaces and in air. 

Since I have added them to my routine, I have seen my trich infestations plummet.  I have seen no degradation of tubs or other materials in the room.  Cultures in petri dishes and tubs are unaffected, as any amount of plastic blocks UV light quite well. 

Your stridency and refusal to engage in productive inquiry just makes me plan to skip by your posts.  If you want to be listened to, you're going to have to mature your style, my friend.


Extras: Filter Print Post Top
InvisiblePastywhyteMDiscord
Say hello to my little friend
Male User Gallery

Registered: 09/15/12
Posts: 37,808
Loc: Canada
Trusted Cultivator
Re: Anyone use UV-C for sterilization? [Re: nickchinn]
    #28629509 - 01/20/24 05:15 PM (7 days, 10 hours ago)

This thread has been closed.

Reason:
I'm gonna keep this short. If you want to play around with potentially dangerous equipment to perform a function not needed to successfully grow at any scale, don't expect the community here to endorse it. Can UV work for the purpose outlined here? Sure. Is it a risk to people to do this? Absolutely. Is it necessary? Hard no. This place is about harm reduction. I've grown more pounds of mushrooms than I can count. Never once needed UV. You want to talk about potentially harmful measures not needed to cultivate at a high level? Then do it somewhere else.


Extras: Filter Print Post Top
Jump to top Pages: 1 | 2 | 3  [ show all ]

Shop: Mushroom-Hut Liquid Cultures   Left Coast Kratom Buy Kratom Capsules   PhytoExtractum Buy Bali Kratom Powder   Original Sensible Seeds Bulk Cannabis Seeds   North Spore Bulk Substrate   Bridgetown Botanicals Bridgetown Botanicals   Kraken Kratom Kratom Capsules for Sale   Unfolding Nature Unfolding Nature: Being in the Implicate Order


Similar ThreadsPosterViewsRepliesLast post
* UV sterileization 2Experimental 3,167 14 07/30/10 06:07 PM
by Doc_T
* Need advice on sterility & trading spores. The_Gnome_King 4,359 16 06/25/20 05:22 AM
by Zakkery
* Every how often do i have to sterilize the misting water? Sterile 2,760 8 10/24/23 12:30 PM
by 10ftTall
* uv light through glass pat126 2,023 12 03/05/17 02:16 PM
by bodhisatta
* Sterilizing lights. Bad for shrooms? Flux 641 2 07/31/03 10:01 AM
by Diploid
* UV Light BOOSTED my mushrooms! RainbowEye 4,238 6 12/07/02 07:53 PM
by TinMan
* UV light? crazycanadian 31,151 10 03/10/18 02:46 PM
by elasticaltiger
* Sterilizing by an UV Light ?! pretorian 953 3 10/08/04 06:47 PM
by scatmanrav

Extra information
You cannot start new topics / You cannot reply to topics
HTML is disabled / BBCode is enabled
Moderator: Shroomism, george castanza, RogerRabbit, veggie, mushboy, fahtster, LogicaL Chaos, 13shrooms, Stipe-n Cap, Pastywhyte, bodhisatta, Tormato, Land Trout, A.k.a
850 topic views. 17 members, 189 guests and 63 web crawlers are browsing this forum.
[ Show Images Only | Sort by Score | Print Topic ]
Search this thread:

Copyright 1997-2024 Mind Media. Some rights reserved.

Generated in 0.039 seconds spending 0.007 seconds on 12 queries.