Home | Community | Message Board

MushroomMan Mycology
This site includes paid links. Please support our sponsors.


Welcome to the Shroomery Message Board! You are experiencing a small sample of what the site has to offer. Please login or register to post messages and view our exclusive members-only content. You'll gain access to additional forums, file attachments, board customizations, encrypted private messages, and much more!

Shop: PhytoExtractum Kratom Powder for Sale   North Spore Injection Grain Bag   Unfolding Nature Unfolding Nature: Being in the Implicate Order   Kraken Kratom Kratom Capsules for Sale   Left Coast Kratom Buy Kratom Extract   Bridgetown Botanicals CBD Concentrates   Original Sensible Seeds Bulk Cannabis Seeds   Mushroom-Hut Substrate Bags

Jump to first unread post Pages: 1
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: nickchinn]
    #28620049 - 01/13/24 05:48 PM (14 days, 9 hours ago)

So why not install a couple lights in your HVAC system on the other side of your filter so you lights don't get dirty? To remain on at all times and purify the air as is passes by the lights just be sure to shield your filter from light so it doesn't get destroyed

I think I'm running a couple 24w uvc in the HVAC

Uvc can make silicone crumble after less than a year as well, makeshift fishtank parasite killer/oxengenator. Be careful dangerous in lots of ways not just eye damage, lung damage ect

It creates ozone and hits pollen spores ECT with so much energy it knocks DNA out of place and replaces it with different molecules or whatever

O3 ozone is very unstable so as long as it gets tumbled around in the air for awhile it becomes 02 and isn't in high concentrations it isn't dangerous but it can be very very bad if used incorrectly

It can smell like chlorine and burn your lungs after it's been turned off it can destroy plastic in minutes, leave it black at the very least

They aren't going to fix your problems or maybe help much for mushrooms but they can keep the over all air cleaner

It can only clean a surface and destroy that surface if it's not resistant to it so it's almost useless for mushrooms, that's what alcohol or a flame or PC is for on most things

In a SAB if the light isn't blocked will turn your tub black

If you don't know what your doing and you just install for a company without knowledge of uvc please stay away from it before you do unrepairable damage to yourself

It's more useful in things like a fish tank with clear water where you can't use chemicals or heat to kill parasites or to oxidize ammonia

Just using the basic mycology tools will lead to way more success than trying to use something you don't fully understand

Please please stay away from it if you have to ask about it instead of understanding how it works and the dangers associated with it

They have lots of space in a store a few low power light bulbs isn't going to be dangerous like it could be at home


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Unfilter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: nickchinn]
    #28620932 - 01/14/24 12:08 PM (13 days, 15 hours ago)

Quote:

nickchinn said:
I install it where the blueprints tell me. I’m not an architectural engineer by no means. I appreciate the attack on my trade as well. That is why I am here asking the question. I have installed it based on plans that have been approved by the government and hospital boards. To kill mold spores that pass through filters, and thought it would be a beneficial idea to my home setup. A simple yes it works or I haven’t seen any results would have been fine HelloImBob. “Please please stay away from it if you have to ask about it instead of understanding how it works and the dangers associated with it” if that is your philosophy on life, then maybe you shouldn’t go to advanced or auto zone and ask for help with replacing spark plugs. If you don’t understand it, just shut up and do what you know? How about you don’t discourage expansion of knowledge and learning new things. I’ll take your advice and next time I have to go to a house with a owner that has your type of attitude, I’ll say, “I can’t do it, I don’t understand and shouldn’t ask questions!” Literally, telling me to not educate myself and ask questions was pretty shitty.




Lol wow I'm sorry I didn't realize I was talking to a little girl on her period who obviously doesn't understand what I'm saying

You sound like one of those kids who has never been told no and just starts throwing a fit instead of asking for better understanding

Some things aren't meant to be toys

Some things do not belong in this hobby except for very special cases if that

I'm all about creative solutions and learning or I wouldn't have bothered replying. I could have just laughed to myself and said some kid is gonna play around with uv-c hahaha

I have another idea let's all replace our lightbulbs with tanning bulbs

Uv-c is amazing but it's mainly for special purposes, outside of those purposes it can be very dangerous to somebody who doesn't know what they are doing with it yet

Is it as dangerous as a kid finding a loaded gun? Probably not but do you get the idea?

All I'm saying is look elsewhere for solutions until you understand it better at the very least

If you don't take the initiative to learn the basics about something complex don't expect somebody to waste their time trying to explain it to you

Sure I could have spent a little more time making sure I wrote more organized or easier to understand but I don't think it would have mattered anyways

Shit grow up a bit I was only trying to warn you it can be dangerous, you went from asking for help to throwing a fit it makes you look really dumb regardless if you are or not

I'm sorry everybody I'm not usually so rude

P.s.
Waytowriteanentiremessagewithoutevenusingaparagraphitmakesitwayeasiertoread


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Unfilter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Nillion]
    #28620955 - 01/14/24 12:29 PM (13 days, 14 hours ago)

Quote:

Nillion said:
It works and most UV-C lights don't create enough ozone to be a big problem. Hospitals use the lights and there doesn't seem to be ozone related health issues associated with working in a hospital.

In fact, when someone is harmed from ozone poisoning they go to a hospital for treatment where UV-C units are common and they recover just fine.

It's also useful for niche applications as a mutagenic agent as mentioned.

It may not offer distinct advantages for cultivators who already have excellent technique or a laminar flow hood.




If you didn't read my post about how o3 breaks down into o2 after being tumbled in the air for awhile being used in HVAC and how stores are large buildings just like hospitals are large

The ozone is supposed to break down or at least get diluted enough before reaching people

A uvc light is an ozone generator in small amounts but it doesn't take much to burn your lungs over time like breathing chlorine if it's used incorrectly and even smells like chlorine if allowed to collect in an area without air movement

Are most people going to run 200+watts of uv-c and create enough ozone to maybe do lung damage? No

But direct exposure to the bulb can cause DNA damage and possibly instant eye damage, I personally don't want to try it to see for sure

I bet you could use a custom blu ray laser pointer to heat your needle red hot instead of a lighter or alcohol lamp

I mean we could all come up with obscure ways to do things instead of the tried and true methods people write teks about for no reason

I'm sorry if I'm being rude but I don't fully understand uvc

maybe because I know enough for what I use it for like fish tanks or HVAC but I've seen it turn silicone to crumbs in less than a year maybe 6 months and do things that make the worst sun burn you have ever seen look like nothing

It scares me

People should be afraid of it if they knew what it could do

The risk to reward ratio on that one is just not worth it


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Unfilter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist]
    #28624791 - 01/17/24 04:19 PM (10 days, 11 hours ago)

And how many people here are going to use it properly compared to not?

It's like playing with fire, there is a higher chance something bad is going to happen than it being helpful.

Plus what is properly in this hobby?

It has it's uses but it's better for fish tanks and post filter HVAC.

It scares me to think somebody who doesn't know what they are doing tries using it only to ruin their eyesight or something.

When something is contaminated get rid of it or do agar transfers or whatever.


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Unfilter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist]
    #28624809 - 01/17/24 04:32 PM (10 days, 10 hours ago)

Quote:

Pscientist said:
Quote:

HelloImBob said:
It's like playing with fire, there is a higher chance something bad is going to happen than it being helpful.






Some may say that about a lot of things in this hobby, it all depends on perspective. It doesn't change facts.




Change what facts that it's simpler to grow mushrooms without using uv-c?

That it's more useful in HVAC or a fish tank?


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Unfilter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist]
    #28624880 - 01/17/24 05:03 PM (10 days, 10 hours ago)

It's useless unless you have a special quartz glass, useless if it's not transparent, useless useless useless for 99% of the people that's might attempt to use it and just end up hurting themselves in the process

Sure there might be some use for it but should people that don't know any better play around with something that has a way higher chance of being dangerous than it does useful?

If you cared about your fellow man you wouldn't defend a topic that could so easily cause them harm without them knowing any better.

They can be dangerous and there is no point to them in this hobby unless your smart enough to figure out that reason on your own.

I'm all ears if you come up with a tek on how to use it correctly

It's not like we're trying to keep a secret hidden from everybody.


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Unfilter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: normalperson]
    #28626108 - 01/18/24 04:13 PM (9 days, 11 hours ago)

I will be so glad when this thread stops being bumped.


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Unfilter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist]
    #28626244 - 01/18/24 05:31 PM (9 days, 9 hours ago)

You sound brilliant.

When you figure out a way to use it, let us know.

Until then I'll only use it for HVAC and fish tanks, EEPROMS ect.

How are you going to sterilize something that grows beneath the surface?

Use agar for cleaning up a culture.

People here waste time and energy trying to do things that will fail instead of doing them the ways that work and have been described in full detail with pictures.

It doesn't get much easier than starting clean grain spawn over and over until you run out of room instead of trying to fix a problem that isn't broken.

Throw out your contams and start over unless your trying to save a rare ass clone or something and in which case you probably aren't in this situation.


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Unfilter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist]
    #28626297 - 01/18/24 06:05 PM (9 days, 9 hours ago)

Lol close minded have you ever used one?

They destroy plastic and tent materials they destroy everything but glass and even oxidize metals horribly except maybe stainless steel.

I have used them in the past and they scare me with how destructive they can be. Silicone is meant to last 50 years in the sun outside. Didn't last 6 months in a gallon jar sealing some uv-c lights around the lid for a fish tank parasite killer.

Do you have any experience with them?

I do

They destroy everything and are dangerous.

I'm smart enough to know that I'm not smart enough to use uv-c for mushrooms if there is a use at all.

Wtf happened to common sense?


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Unfilter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist] * 1
    #28626307 - 01/18/24 06:14 PM (9 days, 9 hours ago)

Lol says the blind guy with DNA damage who likes to play with uv-c

Way to dodge the question if you have experience with them.

If you had experience you would know they destroy plastic and just about everything else.


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Unfilter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist]
    #28626346 - 01/18/24 06:35 PM (9 days, 8 hours ago)

Lol you have no clue because you haven't used them before.

Yes I am smart enough to be afraid of some things, just like being afraid of fire to some extent. Even in a nomex fire suit you can still die of heat even if you don't burn up.

Other things like nitroglycerin scare me too, obliviously if you handle it correctly and keep it cold it shouldn't blow up on you.

I'm not invincible if I make a mistake with uv-c I could cause permanent eye damage or DNA damage, lung damage ect...

I use uv-c for other purposes and I make sure to have switches in other rooms or extension cords away from exposure.

It not only makes plastic brittle it turns it black.

Maybe I should make some examples one day with a CCTV camera recording uv-c vs plastic, I just need another DVR first.

You sound really dumb like you like to play with fire.

Fire has it's uses but can get out of hand really easy just like this thread.


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Unfilter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: Pscientist]
    #28626368 - 01/18/24 06:51 PM (9 days, 8 hours ago)

Lol get some experience playing around with uv-c then come back and talk.

Stupid people act like it's not smart to be afraid of some things then usually end up missing limbs or dead.


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Unfilter Print Post Top
OfflineHelloImBob
Old Guy
I'm a teapot
Registered: 03/30/08
Posts: 219
Last seen: 2 hours, 38 minutes
Re: Anyone use UV-C for sterilization? [Re: OldManRiver]
    #28626432 - 01/18/24 08:02 PM (9 days, 7 hours ago)

Overstating my case? DNA damage is known as what cancer?

Tell me how it's useful below the surface?

It works great in clear water or clean air.

By all means I'm done with this thread. I hope you all play with uv-c I don't give a shit anymore.

This has by far got to be the stupidest thread I've ever wasted my time on.


--------------------
Quote from Stipe-n-Cap

"You appear to be talking about boosting tryptamine content in mycelium by amending LC with....whatever your amendments are. I have to say I'm a tad disappointed that you're addressing us with the shorthand of a 13 yo girl who's texting her besty for make-up tips, instead of proper English, which causes me to have doubts."


Extras: Unfilter Print Post Top
Jump to top Pages: 1

Shop: PhytoExtractum Kratom Powder for Sale   North Spore Injection Grain Bag   Unfolding Nature Unfolding Nature: Being in the Implicate Order   Kraken Kratom Kratom Capsules for Sale   Left Coast Kratom Buy Kratom Extract   Bridgetown Botanicals CBD Concentrates   Original Sensible Seeds Bulk Cannabis Seeds   Mushroom-Hut Substrate Bags


Similar ThreadsPosterViewsRepliesLast post
* UV sterileization 2Experimental 3,167 14 07/30/10 06:07 PM
by Doc_T
* Need advice on sterility & trading spores. The_Gnome_King 4,359 16 06/25/20 05:22 AM
by Zakkery
* Every how often do i have to sterilize the misting water? Sterile 2,760 8 10/24/23 12:30 PM
by 10ftTall
* uv light through glass pat126 2,023 12 03/05/17 02:16 PM
by bodhisatta
* Sterilizing lights. Bad for shrooms? Flux 641 2 07/31/03 10:01 AM
by Diploid
* UV Light BOOSTED my mushrooms! RainbowEye 4,238 6 12/07/02 07:53 PM
by TinMan
* UV light? crazycanadian 31,151 10 03/10/18 02:46 PM
by elasticaltiger
* Sterilizing by an UV Light ?! pretorian 953 3 10/08/04 06:47 PM
by scatmanrav

Extra information
You cannot start new topics / You cannot reply to topics
HTML is disabled / BBCode is enabled
Moderator: Shroomism, george castanza, RogerRabbit, veggie, mushboy, fahtster, LogicaL Chaos, 13shrooms, Stipe-n Cap, Pastywhyte, bodhisatta, Tormato, Land Trout, A.k.a
850 topic views. 17 members, 190 guests and 62 web crawlers are browsing this forum.
[ Show Images Only | Sort by Score | Print Topic ]
Search this thread:

Copyright 1997-2024 Mind Media. Some rights reserved.

Generated in 0.022 seconds spending 0.005 seconds on 15 queries.