|
koods
Ribbit



Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 11 seconds
|
Re: Coronavirus Chat [Re: koods]
#27082206 - 12/10/20 01:28 PM (3 years, 2 months ago) |
|
|
Segue, I’m curious as to the mechanism in which vaccines cause depopulation. Since you claim they are, can you please elucidate how this happens?
--------------------
NotSheekle said “if I believed she was 16 I would become unattracted to her”
|
seagu

Registered: 03/03/18
Posts: 952
Last seen: 13 hours, 54 minutes
|
Re: Coronavirus Chat [Re: koods] 1
#27082242 - 12/10/20 01:50 PM (3 years, 2 months ago) |
|
|
Quote:
koods said: Segue, I’m curious as to the mechanism in which vaccines cause depopulation. Since you claim they are, can you please elucidate how this happens?
Not vaccines in general causing depopulation. If that was anyone's impression then, my mistake. I am and all my family and children are fully vaccinated. I was only referring to a certain group of people that have publicly stated that is their goals. Which, if I may say, some of them have monetary ties to the current groups of vaccines coming out, from what I am starting to gather. I am just starting to follow all the links on this, but it does give me pause.. I certainly don't want to rush anything into my children's bodies. Especially new tech that is fast tracked. We here in the USA had a previous virus out break years back and a vaccine was fast tracked because the President at that time wanted to end it quicker and get us all back to normal and it caused all sort of health problems with people. And so I certainly wouldn't want any government mandate given these sets of things.
-------------------- Plan to win or you are planning for failure. Don't let anyone tell you you can't do it. Just figure out the solution. Even if that means banging your head on a wall until the solution oozes out of you.
|
HamHead
Hard Ass Motherfucker



Registered: 03/17/15
Posts: 6,107
Loc: Galactic sector ZZ9 Plura...
Last seen: 2 years, 8 months
|
Re: Coronavirus Chat [Re: koods]
#27082483 - 12/10/20 03:44 PM (3 years, 2 months ago) |
|
|
Quote:
koods said:
Quote:
Mach z 800 said: Covid is here to stay we just gotta learn to live with.
Covid is here to stay but like other diseases, it will behave differently once a majority of the population has some level of immunity and to it.
A virus that imparts life long immunity after its pandemic phase, such as chickenpox, becomes a childhood disease in its endemic phase. If covid is like this, then only unvaccinated children will get infected in the future because almost all adults will have immunity from previous infection or vaccine. This is a very common outcome and why we have so many “childhood” diseases.
A virus without much chance of significant mutation that imparts shorter immunity, like the common cold viruses, will end up being like the common cold. Something you can get every few years, but because you have some level of immunity, will never progress to serious disease. This is what I expect will happen to covid.
Then you could have a situation like the flu, where mutations occur fast enough that acquired immunity is only partial, and people can still get seriously ill but nothing like the first wave. This is doubtful because coronaviruses don’t mutate and recombine the way flu viruses do.
If covid were a serious childhood disease like polio or smallpox, then the goal would be eradication through vaccination, but we don’t need to do that. A constant low level of partial immunity suppressed covid infections is fine. Life will go on as normal. The important thing to remember is nearly every new virus begins as a pandemic and then the nature of the disease changes radically after most of the population has been exposed or, in modern times, gets vaccinated.
Coronaviruses mutate, quickly.
A virus without much chance of significant mutation that imparts shorter immunity, like the common cold viruses, will end up being like the common cold. Something you can get every few years, but because you have some level of immunity, will never progress to serious disease. This is what I expect will happen to covid.
What are you talking about? A virus with shorter immunity but years later have an immune response?
Sort of like how T cells are responding to SARS1, 17 years later?
-------------------- The Italian researchers’ findings, published by the INT’s scientific magazine Tumori Journal, show 11.6% of 959 healthy volunteers enrolled in a lung cancer screening trial between September 2019 and March 2020 had developed coronavirus antibodies well before February. https://www.reuters.com/article/us-health-coronavirus-italy-timing-idUSKBN27V0KF This online first version has been peer-reviewed, accepted and edited, but not formatted and finalized with corrections from authors and proofreaders https://www.icandecide.org/
|
koods
Ribbit



Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 11 seconds
|
Re: Coronavirus Chat [Re: HamHead]
#27082523 - 12/10/20 04:09 PM (3 years, 2 months ago) |
|
|
If you’re suggesting there is cross immunity between sars1 and sars2, no doubt. Remember that the original vaccine invented to stop smalllox 200 years ago used a completely different virus to produce that immunity. Immunity is not highly specific.
Quote:
What are you talking about? A virus with shorter immunity but years later have an immune response?
Overtime actively circulating antibodies can disappear, but your body remembers how to make more using memory T cells. It’s not as quick a response as free antibodies, but it’s still faster than learning about a virus all over again
Edited by koods (12/10/20 04:15 PM)
|
koods
Ribbit



Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 11 seconds
|
Re: Coronavirus Chat [Re: koods]
#27082545 - 12/10/20 04:16 PM (3 years, 2 months ago) |
|
|
And coronaviruses are slow mutators
--------------------
NotSheekle said “if I believed she was 16 I would become unattracted to her”
|
HamHead
Hard Ass Motherfucker



Registered: 03/17/15
Posts: 6,107
Loc: Galactic sector ZZ9 Plura...
Last seen: 2 years, 8 months
|
Re: Coronavirus Chat [Re: koods]
#27082559 - 12/10/20 04:23 PM (3 years, 2 months ago) |
|
|
-------------------- The Italian researchers’ findings, published by the INT’s scientific magazine Tumori Journal, show 11.6% of 959 healthy volunteers enrolled in a lung cancer screening trial between September 2019 and March 2020 had developed coronavirus antibodies well before February. https://www.reuters.com/article/us-health-coronavirus-italy-timing-idUSKBN27V0KF This online first version has been peer-reviewed, accepted and edited, but not formatted and finalized with corrections from authors and proofreaders https://www.icandecide.org/
|
bodhisatta 
Smurf real estate agent


Registered: 04/30/13
Posts: 61,890
Loc: Milky way
|
Re: Coronavirus Chat [Re: HamHead]
#27082591 - 12/10/20 04:38 PM (3 years, 2 months ago) |
|
|
Cool that's a pitiful amount for a virus that makes millions and millions of copies of itself per individual infected. Especially when it's extremely rare a mutation is advantageous.
|
koods
Ribbit



Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 11 seconds
|
|
Billions. Multiply that times the millions of people infected
The good news is since the vaccine targets the spike protein, if the spike protein mutates enough that it can’t bind to antibodies, it won’t be able to bind to and infect human cells
--------------------
NotSheekle said “if I believed she was 16 I would become unattracted to her”
|
HamHead
Hard Ass Motherfucker



Registered: 03/17/15
Posts: 6,107
Loc: Galactic sector ZZ9 Plura...
Last seen: 2 years, 8 months
|
Re: Coronavirus Chat [Re: koods]
#27082804 - 12/10/20 06:20 PM (3 years, 2 months ago) |
|
|
Not everyone is tested so there's no way of telling how many times it has mutated.
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
TLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQEN

That's just one line.
Talking about isolates, eh?
I bet you my life, another test subject would reveal mutations. Just one letter has to change and it's mutated.
It doesn't have to make it any more lethal or contagious, it's still a mutation.
And yes, it is a pathetic number, considering with every replication there's good chance of mutation, it's most likely impossible to track every mutation of every virus particle being replicated.
Mask or not, people will be exposed and build immunity, without vaccinations.
It's how we've evolved with viruses. They are part of us.
Should look into viruses and their relationship with placenta.
-------------------- The Italian researchers’ findings, published by the INT’s scientific magazine Tumori Journal, show 11.6% of 959 healthy volunteers enrolled in a lung cancer screening trial between September 2019 and March 2020 had developed coronavirus antibodies well before February. https://www.reuters.com/article/us-health-coronavirus-italy-timing-idUSKBN27V0KF This online first version has been peer-reviewed, accepted and edited, but not formatted and finalized with corrections from authors and proofreaders https://www.icandecide.org/
|
feevers



Registered: 12/28/10
Posts: 8,546
Loc:
|
Re: Coronavirus Chat [Re: HamHead]
#27082837 - 12/10/20 06:47 PM (3 years, 2 months ago) |
|
|
People should stop wearing condoms so we can all become immune to HIV and STD viruses. Theyre just a part of us man.
|
koods
Ribbit



Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 11 seconds
|
Re: Coronavirus Chat [Re: feevers]
#27082853 - 12/10/20 07:05 PM (3 years, 2 months ago) |
|
|
Quote:
Should look into viruses and their relationship with placenta.
--------------------
NotSheekle said “if I believed she was 16 I would become unattracted to her”
|
HamHead
Hard Ass Motherfucker



Registered: 03/17/15
Posts: 6,107
Loc: Galactic sector ZZ9 Plura...
Last seen: 2 years, 8 months
|
Re: Coronavirus Chat [Re: koods]
#27082943 - 12/10/20 08:17 PM (3 years, 2 months ago) |
|
|
Quote:
koods said:
Quote:
Should look into viruses and their relationship with placenta.

https://www.pbs.org/wgbh/nova/article/endogenous-retroviruses/
"Early mammals used the spare viral parts left in the junk drawers of the genome to use a viral gene to help create the placenta, and other symbiotic viruses help turn us from a ball of cells into a fully-formed squalling infant and protect us from pathogens."
That's a start. Why don't you go look for yourself instead of having others do the work for you?
-------------------- The Italian researchers’ findings, published by the INT’s scientific magazine Tumori Journal, show 11.6% of 959 healthy volunteers enrolled in a lung cancer screening trial between September 2019 and March 2020 had developed coronavirus antibodies well before February. https://www.reuters.com/article/us-health-coronavirus-italy-timing-idUSKBN27V0KF This online first version has been peer-reviewed, accepted and edited, but not formatted and finalized with corrections from authors and proofreaders https://www.icandecide.org/
|
koods
Ribbit



Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 11 seconds
|
Re: Coronavirus Chat [Re: HamHead]
#27082963 - 12/10/20 08:28 PM (3 years, 2 months ago) |
|
|
Wow you know so much about viruses dude.
--------------------
NotSheekle said “if I believed she was 16 I would become unattracted to her”
|
koods
Ribbit



Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 11 seconds
|
Re: Coronavirus Chat [Re: koods]
#27082966 - 12/10/20 08:29 PM (3 years, 2 months ago) |
|
|
And placentas
--------------------
NotSheekle said “if I believed she was 16 I would become unattracted to her”
|
HamHead
Hard Ass Motherfucker



Registered: 03/17/15
Posts: 6,107
Loc: Galactic sector ZZ9 Plura...
Last seen: 2 years, 8 months
|
Re: Coronavirus Chat [Re: feevers]
#27082967 - 12/10/20 08:29 PM (3 years, 2 months ago) |
|
|
-------------------- The Italian researchers’ findings, published by the INT’s scientific magazine Tumori Journal, show 11.6% of 959 healthy volunteers enrolled in a lung cancer screening trial between September 2019 and March 2020 had developed coronavirus antibodies well before February. https://www.reuters.com/article/us-health-coronavirus-italy-timing-idUSKBN27V0KF This online first version has been peer-reviewed, accepted and edited, but not formatted and finalized with corrections from authors and proofreaders https://www.icandecide.org/
|
HamHead
Hard Ass Motherfucker



Registered: 03/17/15
Posts: 6,107
Loc: Galactic sector ZZ9 Plura...
Last seen: 2 years, 8 months
|
Re: Coronavirus Chat [Re: koods]
#27082971 - 12/10/20 08:32 PM (3 years, 2 months ago) |
|
|
Quote:
koods said: Wow you know so much about viruses dude.
Quote:
koods said: And placentas
Forget how to edit post, koods?
No wonder you've got over 80k post.
Interesting video.
-------------------- The Italian researchers’ findings, published by the INT’s scientific magazine Tumori Journal, show 11.6% of 959 healthy volunteers enrolled in a lung cancer screening trial between September 2019 and March 2020 had developed coronavirus antibodies well before February. https://www.reuters.com/article/us-health-coronavirus-italy-timing-idUSKBN27V0KF This online first version has been peer-reviewed, accepted and edited, but not formatted and finalized with corrections from authors and proofreaders https://www.icandecide.org/
|
koods
Ribbit



Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 11 seconds
|
Re: Coronavirus Chat [Re: HamHead]
#27082976 - 12/10/20 08:34 PM (3 years, 2 months ago) |
|
|
10% of Europeans are immune to the effects of HIV infection and ~2% have a mutation that prevents HIV infection entirely.
WHATS YOUR POINT?
--------------------
NotSheekle said “if I believed she was 16 I would become unattracted to her”
|
koods
Ribbit



Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 11 seconds
|
Re: Coronavirus Chat [Re: HamHead]
#27082977 - 12/10/20 08:36 PM (3 years, 2 months ago) |
|
|
Quote:
HamHead said:
Quote:
koods said: Wow you know so much about viruses dude.
Quote:
koods said: And placentas
Forget how to edit post, koods?
No wonder you've got over 80k post.
Interesting video.
Making two posts was a stylistic choice
--------------------
NotSheekle said “if I believed she was 16 I would become unattracted to her”
|
HamHead
Hard Ass Motherfucker



Registered: 03/17/15
Posts: 6,107
Loc: Galactic sector ZZ9 Plura...
Last seen: 2 years, 8 months
|
Re: Coronavirus Chat [Re: koods]
#27083037 - 12/10/20 09:09 PM (3 years, 2 months ago) |
|
|
Quote:
koods said:
Quote:
HamHead said:
Quote:
koods said: Wow you know so much about viruses dude.
Quote:
koods said: And placentas
Forget how to edit post, koods?
No wonder you've got over 80k post.
Interesting video.
Making two posts was a stylistic choice

Quote:
koods said: 10% of Europeans are immune to the effects of HIV infection and ~2% have a mutation that prevents HIV infection entirely.
WHATS YOUR POINT?
Ask feevers, he's the one who thinks we should all stop wearing condoms. Maybe that's his point, feevers is anticondom and doesn't believe in aids.
-------------------- The Italian researchers’ findings, published by the INT’s scientific magazine Tumori Journal, show 11.6% of 959 healthy volunteers enrolled in a lung cancer screening trial between September 2019 and March 2020 had developed coronavirus antibodies well before February. https://www.reuters.com/article/us-health-coronavirus-italy-timing-idUSKBN27V0KF This online first version has been peer-reviewed, accepted and edited, but not formatted and finalized with corrections from authors and proofreaders https://www.icandecide.org/
|
koods
Ribbit



Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 11 seconds
|
Re: Coronavirus Chat [Re: HamHead] 1
#27083090 - 12/10/20 09:43 PM (3 years, 2 months ago) |
|
|
No Need. Everyone but you understands he was being sarcastic to make a point about the silliness of your ideas. It was not a commentary about HIV.
--------------------
NotSheekle said “if I believed she was 16 I would become unattracted to her”
|
|