Home | Community | Message Board

Cannabis Seeds UK
This site includes paid links. Please support our sponsors.


Welcome to the Shroomery Message Board! You are experiencing a small sample of what the site has to offer. Please login or register to post messages and view our exclusive members-only content. You'll gain access to additional forums, file attachments, board customizations, encrypted private messages, and much more!

Shop: Unfolding Nature Unfolding Nature: Being in the Implicate Order   Kraken Kratom Kratom Capsules for Sale, Red Vein Kratom

Jump to first unread post Pages: < First | < Back | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | Next > | Last >
Onlinekoods
Ribbit
Male User Gallery


Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 10 seconds
Re: Coronavirus Chat [Re: koods]
    #27082206 - 12/10/20 01:28 PM (3 years, 2 months ago)

Segue, I’m curious as to the mechanism in which vaccines cause depopulation. Since you claim they are, can you please elucidate how this happens?


--------------------
NotSheekle said
“if I believed she was 16 I would become unattracted to her”


Extras: Filter Print Post Top
Offlineseagu

Registered: 03/03/18
Posts: 952
Last seen: 13 hours, 54 minutes
Re: Coronavirus Chat [Re: koods] * 1
    #27082242 - 12/10/20 01:50 PM (3 years, 2 months ago)

Quote:

koods said:
Segue, I’m curious as to the mechanism in which vaccines cause depopulation. Since you claim they are, can you please elucidate how this happens?




Not vaccines in general causing depopulation. If that was anyone's impression then, my mistake. I am and all my family and children are fully vaccinated. I was only referring to a certain group of people that have publicly stated that is their goals. Which, if I may say, some of them have monetary ties to the current groups of vaccines coming out, from what I am starting to gather. I am just starting to follow all the links on this, but it does give me pause.. I certainly don't want to rush anything into my children's bodies. Especially new tech that is fast tracked. We here in the USA had a previous virus out break years back and a vaccine was fast tracked because the President at that time wanted to end it quicker and get us all back to normal and it caused all sort of health problems with people. And so I certainly wouldn't want any government mandate given these sets of things.


--------------------
Plan to win or you are planning for failure. Don't let anyone tell you you can't do it. Just figure out the solution. Even if that means banging your head on a wall until the solution oozes out of you.


Extras: Filter Print Post Top
OfflineHamHead
Hard Ass Motherfucker
Male


Registered: 03/17/15
Posts: 6,107
Loc: Galactic sector ZZ9 Plura...
Last seen: 2 years, 8 months
Re: Coronavirus Chat [Re: koods]
    #27082483 - 12/10/20 03:44 PM (3 years, 2 months ago)

Quote:

koods said:
Quote:

Mach z 800 said:
Covid is here to stay we just gotta learn to live with.




Covid is here to stay but like other diseases, it will behave differently once a majority of the population has some level of immunity and to it.

A virus that imparts life long immunity after its pandemic phase, such as chickenpox, becomes a childhood disease in its endemic phase. If covid is like this, then only unvaccinated children will get infected in the future because almost all adults will have immunity from previous infection or vaccine. This is a very common outcome and why we have so many “childhood” diseases.

A virus without much chance of significant mutation that imparts shorter immunity, like the common cold viruses, will end up being like the common cold. Something you can get every few years, but because you have some level of immunity, will never progress to serious disease. This is what I expect will happen to covid.

Then you could have a situation like the flu, where mutations occur fast enough that acquired immunity is only partial, and people can still get seriously ill but nothing like the first wave. This is doubtful because coronaviruses don’t mutate and recombine the way flu viruses do.

If covid were a serious childhood disease like polio or smallpox, then the goal would be eradication through vaccination, but we don’t need to do that. A constant low level of partial immunity suppressed covid infections is fine. Life will go on as normal. The important thing to remember is nearly every new virus begins as a pandemic and then the nature of the disease changes radically after most of the population has been exposed or, in modern times, gets vaccinated.




Coronaviruses mutate, quickly.

A virus without much chance of significant mutation that imparts shorter immunity, like the common cold viruses, will end up being like the common cold. Something you can get every few years, but because you have some level of immunity, will never progress to serious disease. This is what I expect will happen to covid.

What are you talking about? A virus with shorter immunity but years later have an immune response?

Sort of like how T cells are responding to SARS1, 17 years later?


--------------------
The Italian researchers’ findings, published by the INT’s scientific magazine Tumori Journal, show 11.6% of 959 healthy volunteers enrolled in a lung cancer screening trial between September 2019 and March 2020 had developed coronavirus antibodies well before February.

https://www.reuters.com/article/us-health-coronavirus-italy-timing-idUSKBN27V0KF

This online first version has been peer-reviewed, accepted and edited,  but not formatted and finalized with corrections from authors and proofreaders

https://www.icandecide.org/


Extras: Filter Print Post Top
Onlinekoods
Ribbit
Male User Gallery


Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 10 seconds
Re: Coronavirus Chat [Re: HamHead]
    #27082523 - 12/10/20 04:09 PM (3 years, 2 months ago)

If you’re suggesting there is cross immunity between sars1 and sars2, no doubt. Remember that the original vaccine invented to stop smalllox 200 years ago used a completely different virus to produce that immunity. Immunity is not highly specific.

Quote:

What are you talking about? A virus with shorter immunity but years later have an immune response?




Overtime actively circulating antibodies can disappear, but your body remembers how to make more using memory T cells. It’s not as quick a response as free antibodies, but it’s still faster than learning about a virus all over again


Edited by koods (12/10/20 04:15 PM)


Extras: Filter Print Post Top
Onlinekoods
Ribbit
Male User Gallery


Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 10 seconds
Re: Coronavirus Chat [Re: koods]
    #27082545 - 12/10/20 04:16 PM (3 years, 2 months ago)

And coronaviruses are slow mutators


--------------------
NotSheekle said
“if I believed she was 16 I would become unattracted to her”


Extras: Filter Print Post Top
OfflineHamHead
Hard Ass Motherfucker
Male


Registered: 03/17/15
Posts: 6,107
Loc: Galactic sector ZZ9 Plura...
Last seen: 2 years, 8 months
Re: Coronavirus Chat [Re: koods]
    #27082559 - 12/10/20 04:23 PM (3 years, 2 months ago)

Quote:

koods said:
And coronaviruses are slow mutators




To date we have identified fourteen mutations in Spike that are accumulating.


--------------------
The Italian researchers’ findings, published by the INT’s scientific magazine Tumori Journal, show 11.6% of 959 healthy volunteers enrolled in a lung cancer screening trial between September 2019 and March 2020 had developed coronavirus antibodies well before February.

https://www.reuters.com/article/us-health-coronavirus-italy-timing-idUSKBN27V0KF

This online first version has been peer-reviewed, accepted and edited,  but not formatted and finalized with corrections from authors and proofreaders

https://www.icandecide.org/


Extras: Filter Print Post Top
InvisiblebodhisattaMDiscordReddit
Smurf real estate agent
 User Gallery
Folding@home Statistics
Registered: 04/30/13
Posts: 61,890
Loc: Milky way
Re: Coronavirus Chat [Re: HamHead]
    #27082591 - 12/10/20 04:38 PM (3 years, 2 months ago)

Cool that's a pitiful amount for a virus that makes millions and millions of copies of itself per individual infected. Especially when it's extremely rare a mutation is advantageous.


Extras: Filter Print Post Top
Onlinekoods
Ribbit
Male User Gallery


Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 10 seconds
Re: Coronavirus Chat [Re: bodhisatta]
    #27082631 - 12/10/20 04:53 PM (3 years, 2 months ago)

Billions. Multiply that times the millions of people infected

The good news is since the vaccine targets the spike protein, if the spike protein mutates enough that it can’t bind to antibodies, it won’t be able to bind to and infect human cells


--------------------
NotSheekle said
“if I believed she was 16 I would become unattracted to her”


Extras: Filter Print Post Top
OfflineHamHead
Hard Ass Motherfucker
Male


Registered: 03/17/15
Posts: 6,107
Loc: Galactic sector ZZ9 Plura...
Last seen: 2 years, 8 months
Re: Coronavirus Chat [Re: koods]
    #27082804 - 12/10/20 06:20 PM (3 years, 2 months ago)

Not everyone is tested so there's no way of telling how many times it has mutated. 

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)

TLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQEN

:canthelpbutlaugh:

That's just one line.

Talking about isolates, eh?

I bet you my life, another test subject would reveal mutations. Just one letter has to change and it's mutated.

It doesn't have to make it any more lethal or contagious, it's still a mutation.

And yes, it is a pathetic number, considering with every replication there's good chance of mutation, it's most likely impossible to track every mutation of every virus particle being replicated.

Mask or not, people will be exposed and build immunity, without vaccinations.

It's how we've evolved with viruses. They are part of us.

Should look into viruses and their relationship with placenta.


--------------------
The Italian researchers’ findings, published by the INT’s scientific magazine Tumori Journal, show 11.6% of 959 healthy volunteers enrolled in a lung cancer screening trial between September 2019 and March 2020 had developed coronavirus antibodies well before February.

https://www.reuters.com/article/us-health-coronavirus-italy-timing-idUSKBN27V0KF

This online first version has been peer-reviewed, accepted and edited,  but not formatted and finalized with corrections from authors and proofreaders

https://www.icandecide.org/


Extras: Filter Print Post Top
InvisiblefeeversM
Male


Registered: 12/28/10
Posts: 8,546
Loc: Flag
Re: Coronavirus Chat [Re: HamHead]
    #27082837 - 12/10/20 06:47 PM (3 years, 2 months ago)

People should stop wearing condoms so we can all become immune to HIV and STD viruses. Theyre just a part of us man.


Extras: Filter Print Post Top
Onlinekoods
Ribbit
Male User Gallery


Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 10 seconds
Re: Coronavirus Chat [Re: feevers]
    #27082853 - 12/10/20 07:05 PM (3 years, 2 months ago)

Quote:

Should look into viruses and their relationship with placenta.




:pleasetellmemore:


--------------------
NotSheekle said
“if I believed she was 16 I would become unattracted to her”


Extras: Filter Print Post Top
OfflineHamHead
Hard Ass Motherfucker
Male


Registered: 03/17/15
Posts: 6,107
Loc: Galactic sector ZZ9 Plura...
Last seen: 2 years, 8 months
Re: Coronavirus Chat [Re: koods]
    #27082943 - 12/10/20 08:17 PM (3 years, 2 months ago)

Quote:

koods said:
Quote:

Should look into viruses and their relationship with placenta.




:pleasetellmemore:




https://www.pbs.org/wgbh/nova/article/endogenous-retroviruses/

"Early mammals used the spare viral parts left in the junk drawers of the genome to use a viral gene to help create the placenta, and other symbiotic viruses help turn us from a ball of cells into a fully-formed squalling infant and protect us from pathogens."

That's a start. Why don't you go look for yourself instead of having others do the work for you?


--------------------
The Italian researchers’ findings, published by the INT’s scientific magazine Tumori Journal, show 11.6% of 959 healthy volunteers enrolled in a lung cancer screening trial between September 2019 and March 2020 had developed coronavirus antibodies well before February.

https://www.reuters.com/article/us-health-coronavirus-italy-timing-idUSKBN27V0KF

This online first version has been peer-reviewed, accepted and edited,  but not formatted and finalized with corrections from authors and proofreaders

https://www.icandecide.org/


Extras: Filter Print Post Top
Onlinekoods
Ribbit
Male User Gallery


Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 10 seconds
Re: Coronavirus Chat [Re: HamHead]
    #27082963 - 12/10/20 08:28 PM (3 years, 2 months ago)

Wow you know so much about viruses dude.


--------------------
NotSheekle said
“if I believed she was 16 I would become unattracted to her”


Extras: Filter Print Post Top
Onlinekoods
Ribbit
Male User Gallery


Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 10 seconds
Re: Coronavirus Chat [Re: koods]
    #27082966 - 12/10/20 08:29 PM (3 years, 2 months ago)

And placentas


--------------------
NotSheekle said
“if I believed she was 16 I would become unattracted to her”


Extras: Filter Print Post Top
OfflineHamHead
Hard Ass Motherfucker
Male


Registered: 03/17/15
Posts: 6,107
Loc: Galactic sector ZZ9 Plura...
Last seen: 2 years, 8 months
Re: Coronavirus Chat [Re: feevers]
    #27082967 - 12/10/20 08:29 PM (3 years, 2 months ago)



--------------------
The Italian researchers’ findings, published by the INT’s scientific magazine Tumori Journal, show 11.6% of 959 healthy volunteers enrolled in a lung cancer screening trial between September 2019 and March 2020 had developed coronavirus antibodies well before February.

https://www.reuters.com/article/us-health-coronavirus-italy-timing-idUSKBN27V0KF

This online first version has been peer-reviewed, accepted and edited,  but not formatted and finalized with corrections from authors and proofreaders

https://www.icandecide.org/


Extras: Filter Print Post Top
OfflineHamHead
Hard Ass Motherfucker
Male


Registered: 03/17/15
Posts: 6,107
Loc: Galactic sector ZZ9 Plura...
Last seen: 2 years, 8 months
Re: Coronavirus Chat [Re: koods]
    #27082971 - 12/10/20 08:32 PM (3 years, 2 months ago)

Quote:

koods said:
Wow you know so much about viruses dude.



Quote:

koods said:
And placentas




Forget how to edit post, koods?

No wonder you've got over 80k post.

Interesting video.


--------------------
The Italian researchers’ findings, published by the INT’s scientific magazine Tumori Journal, show 11.6% of 959 healthy volunteers enrolled in a lung cancer screening trial between September 2019 and March 2020 had developed coronavirus antibodies well before February.

https://www.reuters.com/article/us-health-coronavirus-italy-timing-idUSKBN27V0KF

This online first version has been peer-reviewed, accepted and edited,  but not formatted and finalized with corrections from authors and proofreaders

https://www.icandecide.org/


Extras: Filter Print Post Top
Onlinekoods
Ribbit
Male User Gallery


Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 10 seconds
Re: Coronavirus Chat [Re: HamHead]
    #27082976 - 12/10/20 08:34 PM (3 years, 2 months ago)

10% of Europeans are immune to the effects of HIV infection and ~2% have a mutation that prevents HIV infection entirely.

WHATS YOUR POINT?


--------------------
NotSheekle said
“if I believed she was 16 I would become unattracted to her”


Extras: Filter Print Post Top
Onlinekoods
Ribbit
Male User Gallery


Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 10 seconds
Re: Coronavirus Chat [Re: HamHead]
    #27082977 - 12/10/20 08:36 PM (3 years, 2 months ago)

Quote:

HamHead said:
Quote:

koods said:
Wow you know so much about viruses dude.



Quote:

koods said:
And placentas




Forget how to edit post, koods?

No wonder you've got over 80k post.

Interesting video.




Making two posts was a stylistic choice


--------------------
NotSheekle said
“if I believed she was 16 I would become unattracted to her”


Extras: Filter Print Post Top
OfflineHamHead
Hard Ass Motherfucker
Male


Registered: 03/17/15
Posts: 6,107
Loc: Galactic sector ZZ9 Plura...
Last seen: 2 years, 8 months
Re: Coronavirus Chat [Re: koods]
    #27083037 - 12/10/20 09:09 PM (3 years, 2 months ago)

Quote:

koods said:
Quote:

HamHead said:
Quote:

koods said:
Wow you know so much about viruses dude.



Quote:

koods said:
And placentas




Forget how to edit post, koods?

No wonder you've got over 80k post.

Interesting video.




Making two posts was a stylistic choice




:whateveryousayfreak:

Quote:

koods said:
10% of Europeans are immune to the effects of HIV infection and ~2% have a mutation that prevents HIV infection entirely.

WHATS YOUR POINT?




Ask feevers, he's the one who thinks we should all stop wearing condoms. Maybe that's his point, feevers is anticondom and doesn't believe in aids.


--------------------
The Italian researchers’ findings, published by the INT’s scientific magazine Tumori Journal, show 11.6% of 959 healthy volunteers enrolled in a lung cancer screening trial between September 2019 and March 2020 had developed coronavirus antibodies well before February.

https://www.reuters.com/article/us-health-coronavirus-italy-timing-idUSKBN27V0KF

This online first version has been peer-reviewed, accepted and edited,  but not formatted and finalized with corrections from authors and proofreaders

https://www.icandecide.org/


Extras: Filter Print Post Top
Onlinekoods
Ribbit
Male User Gallery


Registered: 05/26/11
Posts: 106,333
Loc: Maryland/DC Burbs
Last seen: 6 minutes, 10 seconds
Re: Coronavirus Chat [Re: HamHead] * 1
    #27083090 - 12/10/20 09:43 PM (3 years, 2 months ago)

No Need. Everyone but you understands he was being sarcastic to make a point about the silliness of your ideas. It was not a commentary about HIV.


--------------------
NotSheekle said
“if I believed she was 16 I would become unattracted to her”


Extras: Filter Print Post Top
Jump to top Pages: < First | < Back | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | Next > | Last >

Shop: Unfolding Nature Unfolding Nature: Being in the Implicate Order   Kraken Kratom Kratom Capsules for Sale, Red Vein Kratom


Similar ThreadsPosterViewsRepliesLast post
* Credibility fft2 677 7 07/15/04 07:08 PM
by Redo
* Christians on PalTalk Chat Service Tracked by Radical Islamic Web Site Rogues_Pierre 721 0 03/06/06 08:37 AM
by Rogues_Pierre
* Another rant about JFK and the government's credibility
( 1 2 all )
LearyfanS 1,838 26 06/08/03 04:08 PM
by mike
* PATERSON'S EXCUSE IS SIMPLY INN-CREDIBLE lonestar2004 480 5 03/25/08 09:50 AM
by lonestar2004
* WWII in chat newuser1492 564 4 07/22/05 10:27 AM
by Madtowntripper
* Capitalism at work
( 1 2 3 4 ... 24 25 )
Bigbadwooof 17,383 480 10/30/15 08:29 PM
by hostileuniverse
* This is why we need GMO labeling
( 1 2 3 4 ... 123 124 )
sweeper54 99,348 2,475 12/02/16 08:51 AM
by hostileuniverse
* Bernie 2016!
( 1 2 3 4 ... 250 251 )
elax420 116,019 5,003 01/14/17 04:00 AM
by GPryder

Extra information
You cannot start new topics / You cannot reply to topics
HTML is disabled / BBCode is enabled
Moderator: Enlil, ballsalsa
59,122 topic views. 3 members, 5 guests and 3 web crawlers are browsing this forum.
[ Show Images Only | Sort by Score | Print Topic ]
Search this thread:

Copyright 1997-2024 Mind Media. Some rights reserved.

Generated in 0.03 seconds spending 0.009 seconds on 14 queries.